Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT33RZWY)

• DOT Name: E-selectin (SELE)
• Synonyms: CD62 antigen-like family member E; Endothelial leukocyte adhesion molecule 1; ELAM-1; Leukocyte-endothelial cell adhesion molecule 2; LECAM2; CD antigen CD62E
• Gene Name: SELE
• UniProt ID: LYAM2_HUMAN
• PDB ID: 1ESL; 1G1T; 4C16; 4CSY; 6EYI; 6EYJ; 6EYK
• Pfam ID: PF00008 ; PF00059 ; PF00084
• Sequence:
  MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLN
  SILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREK
  DVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNC
  TALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVV
  ECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCK
  AVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIP
  VCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDN
  EKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQ
  WTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHW
  SGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESD
  GSYQKPSYIL
• Function: Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with SELPLG/PSGL1. May have a role in capillary morphogenesis.
• KEGG Pathway:
  Cell adhesion molecules (hsa04514)
  TNF sig.ling pathway (hsa04668)
  AGE-RAGE sig.ling pathway in diabetic complications (hsa04933)
  African trypanosomiasis (hsa05143)
  Malaria (hsa05144)
  Lipid and atherosclerosis (hsa05417)
  Fluid shear stress and atherosclerosis (hsa05418)
• Reactome Pathway: Cell surface interactions at the vascular wall (R-HSA-202733)

Molecular Interaction Atlas (MIA) of This DOT

29 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of E-selectin (SELE).	[1]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of E-selectin (SELE).	[2]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of E-selectin (SELE).	[3]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of E-selectin (SELE).	[4]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of E-selectin (SELE).	[5]
Simvastatin	DM30SGU	Approved	Simvastatin decreases the expression of E-selectin (SELE).	[6]
Sertraline	DM0FB1J	Approved	Sertraline decreases the expression of E-selectin (SELE).	[7]
Chenodiol	DMQ8JIK	Approved	Chenodiol increases the expression of E-selectin (SELE).	[8]
Deoxycholic acid	DM3GYAL	Approved	Deoxycholic acid increases the expression of E-selectin (SELE).	[8]
Sulfasalazine	DMICA9H	Approved	Sulfasalazine increases the expression of E-selectin (SELE).	[9]
Erythromycin	DM4K7GQ	Approved	Erythromycin increases the expression of E-selectin (SELE).	[10]
Tibolone	DM78XFG	Approved	Tibolone decreases the expression of E-selectin (SELE).	[11]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of E-selectin (SELE).	[12]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of E-selectin (SELE).	[13]
Curcumin	DMQPH29	Phase 3	Curcumin affects the expression of E-selectin (SELE).	[14]
Fenretinide	DMRD5SP	Phase 3	Fenretinide increases the expression of E-selectin (SELE).	[15]
Atorvastatin	DMF28YC	Phase 3 Trial	Atorvastatin increases the expression of E-selectin (SELE).	[16]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of E-selectin (SELE).	[17]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of E-selectin (SELE).	[19]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid increases the expression of E-selectin (SELE).	[20]
D-glucose	DMMG2TO	Investigative	D-glucose increases the expression of E-selectin (SELE).	[21]
Dibutyl phthalate	DMEDGKO	Investigative	Dibutyl phthalate increases the expression of E-selectin (SELE).	[22]
Cordycepin	DM72Y01	Investigative	Cordycepin increases the expression of E-selectin (SELE).	[23]
27-hydroxycholesterol	DM2L6OZ	Investigative	27-hydroxycholesterol increases the expression of E-selectin (SELE).	[24]
GW-3965	DMG60ET	Investigative	GW-3965 increases the expression of E-selectin (SELE).	[24]
T0901317	DMZQVDI	Investigative	T0901317 increases the expression of E-selectin (SELE).	[24]
CHLORANIL	DMCHGF1	Investigative	CHLORANIL increases the expression of E-selectin (SELE).	[25]
PAF	DMRZAQW	Investigative	PAF increases the expression of E-selectin (SELE).	[26]
24(S), 25-epoxycholesterol	DMW2KI5	Investigative	24(S), 25-epoxycholesterol increases the expression of E-selectin (SELE).	[24]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of E-selectin (SELE).	[18]

References

• [1] Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
• [2] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [3] Vitamin E inhibits lipid peroxidation-induced adhesion molecule expression in endothelial cells and decreases soluble cell adhesion molecules in healthy subjects. Cardiovasc Res. 2003 Feb;57(2):563-71. doi: 10.1016/s0008-6363(02)00699-5.
• [4] Reduction of synovial sublining layer inflammation and proinflammatory cytokine expression in psoriatic arthritis treated with methotrexate. Arthritis Rheum. 2004 Oct;50(10):3286-95. doi: 10.1002/art.20518.
• [5] Rapid effects of rosiglitazone treatment on endothelial function and inflammatory biomarkers. Arterioscler Thromb Vasc Biol. 2005 Sep;25(9):1804-9. doi: 10.1161/01.ATV.0000176192.16951.9a. Epub 2005 Jul 7.
• [6] Effects of bezafibrate and simvastatin on endothelial activation and lipid peroxidation in hypercholesterolemia: evidence of different vascular protection by different lipid-lowering treatments. J Clin Endocrinol Metab. 2003 Nov;88(11):5341-7. doi: 10.1210/jc.2003-030724.
• [7] Platelet/endothelial biomarkers in depressed patients treated with the selective serotonin reuptake inhibitor sertraline after acute coronary events: the Sertraline AntiDepressant Heart Attack Randomized Trial (SADHART) Platelet Substudy. Circulation. 2003 Aug 26;108(8):939-44. doi: 10.1161/01.CIR.0000085163.21752.0A. Epub 2003 Aug 11.
• [8] Bile acids induce adhesion molecule expression in endothelial cells through activation of reactive oxygen species, NF-kappaB, and p38. Am J Physiol Heart Circ Physiol. 2006 Aug;291(2):H741-7. doi: 10.1152/ajpheart.01182.2005. Epub 2006 Mar 31.
• [9] Modulation of endothelial cell activation in sickle cell disease: a pilot study. Blood. 2001 Apr 1;97(7):1937-41. doi: 10.1182/blood.v97.7.1937.
• [10] The in vitro effects of quinupristin/dalfopristin, erythromycin and levofloxacin at low concentrations on the expression of different cell adhesion molecules on the surface of endothelial cells (Eahy926). Toxicology. 2006 Jan 20;218(1):30-8. doi: 10.1016/j.tox.2005.09.014. Epub 2005 Nov 16.
• [11] Effects of hormone treatment on hemostasis variables. Climacteric. 2007 Oct;10 Suppl 2:32-7. doi: 10.1080/13697130701598548.
• [12] Differential regulation of proliferation, cell cycle control and gene expression in cultured human aortic and pulmonary artery endothelial cells by resveratrol. Int J Mol Med. 2010 Nov;26(5):743-9.
• [13] Molecular mechanisms of action of angiopreventive anti-oxidants on endothelial cells: microarray gene expression analyses. Mutat Res. 2005 Dec 11;591(1-2):198-211.
• [14] Opposing effects of curcuminoids on serum stimulated and unstimulated angiogenic response. J Cell Physiol. 2008 Apr;215(1):251-64. doi: 10.1002/jcp.21307.
• [15] The transforming growth factor-beta family members bone morphogenetic protein-2 and macrophage inhibitory cytokine-1 as mediators of the antiangiogenic activity of N-(4-hydroxyphenyl)retinamide. Clin Cancer Res. 2005 Jun 15;11(12):4610-9.
• [16] Markers of inflammation, thrombosis and endothelial activation correlate with carotid IMT regression in stable coronary disease after atorvastatin treatment. Nutr Metab Cardiovasc Dis. 2009 Sep;19(7):481-90. doi: 10.1016/j.numecd.2008.10.003. Epub 2009 Jan 26.
• [17] Action of cAMP on expression and release of adhesion molecules in human endothelial cells. Am J Physiol. 1996 Mar;270(3 Pt 2):H807-16. doi: 10.1152/ajpheart.1996.270.3.H807.
• [18] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [19] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [20] Palmitate-induced endothelial dysfunction is attenuated by cyanidin-3-O-glucoside through modulation of Nrf2/Bach1 and NF-B pathways. Toxicol Lett. 2015 Dec 15;239(3):152-60.
• [21] Intermittent high glucose enhances ICAM-1, VCAM-1, E-selectin and interleukin-6 expression in human umbilical endothelial cells in culture: the role of poly(ADP-ribose) polymerase. J Thromb Haemost. 2004 Aug;2(8):1453-9. doi: 10.1111/j.1538-7836.2004.00835.x.
• [22] Integration of data from the in vitro long-term exposure study on human endothelial cells and the in silico analysis: A case of dibutyl phthalate-induced vascular dysfunction. Toxicol Lett. 2022 Mar 1;356:64-74. doi: 10.1016/j.toxlet.2021.12.006. Epub 2021 Dec 10.
• [23] Cordycepin inhibits the proliferation and progression of NPC by targeting the MAPK/ERK and -catenin pathways. Oncol Lett. 2022 Jan;23(1):20. doi: 10.3892/ol.2021.13138. Epub 2021 Nov 16.
• [24] LXR-activating oxysterols induce the expression of inflammatory markers in endothelial cells through LXR-independent mechanisms. Atherosclerosis. 2009 Nov;207(1):38-44.
• [25] Tetrachlorobenzoquinone Stimulates NLRP3 Inflammasome-Mediated Post-Translational Activation and Secretion of IL-1 in the HUVEC Endothelial Cell Line. Chem Res Toxicol. 2016 Mar 21;29(3):421-9. doi: 10.1021/acs.chemrestox.6b00021. Epub 2016 Mar 1.
• [26] Oxidized phospholipid: POVPC binds to platelet-activating-factor receptor on human macrophagesImplications in atherosclerosis. Atherosclerosis. 2006 Oct;188(2):433-43.