Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3W21WR)

DOT Name MYCBP-associated protein (MYCBPAP)
Synonyms AMAM-1; AMY-1-binding protein 1; AMAP-1
Gene Name MYCBPAP
Related Disease
Advanced cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Head and neck cancer ( )
Head and neck carcinoma ( )
Head-neck squamous cell carcinoma ( )
Pancreatic cancer ( )
Neoplasm ( )
Invasive breast carcinoma ( )
UniProt ID
MYBPP_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF14646
Sequence
MRAPARGTGCCGRSGGRWLAGAAQPRCLWAGGAGQRFMVPGGTMKSLKKDSRLRITPTRL
LEASENVKEKKRAKGPEQPTPTIQEEPEPVSNVLQGDDILALAIKKEDLKEQHIPRLTEK
EDKRVITQKFIIRKLKPMDPRRKVCHLVARPANPDEATKPLDYSGPGDSFDGSDQILPHH
ILGSLQDFKRIALARGNTQLAERIPTSPCLMTLISAEGESKQKAPKEEKRPPWAPPPQHN
FLKNWQRNTALRKKQQEALSEHLKKPVSELLMHTGETYRRIQEERELIDCTLPTRRDRKS
WENSGFWSRLEYLGDEMTGLVMTKTKTQRGLMEPITHIRKPHSIRVETGLPAQRDASYRY
TWDRSLFLIYRRKELQRIMEELDFSQQDIDGLEVVGKGWPFSAVTVEDYTVFERSQGSSS
EDTAYLGTLASSSDVSMPILGPSLLFCGKPACWIRGSNPQDKRQVGIAAHLTFETLEGEK
TSSELTVVNNGTVAIWYDWRRQHQPDTFQDLKKNRMQRFYFDNREGVILPGEIKTFTFFF
KSLTAGVFREFWEFRTHPTLLGGAILQVNLHAVSLTQDVFEDERKVLESKLTAHEAVTVV
REVLQELLMGVLTPERTPSPVDAYLTEEDLFRHRNPPLHYEHQVVQSLHQLWRQYMTLPA
KAEEARPGDKEHVSPIATEKASVNAELLPRFRSPISETQVPRPENEALRESGSQKARVGT
KSPQRKSIMEEILVEESPDVDSTKSPWEPDGLPLLEWNLCLEDFRKAVMVLPDENHREDA
LMRLNKAALELCQKPRPLQSNLLHQMCLQLWRDVIDSLVGHSMWLRSVLGLPEKETIYLN
VPEEQDQKSPPIMEVKVPVGKAGKEERKGAAQEKKQLGIKDKEDKKGAKLLGKEDRPNSK
KHKAKDDKKVIKSASQDRFSLEDPTPDIILSSQEPIDPLVMGKYTQSLHSEVRGLLDTLV
TDLMVLADELSPIKNVEEALRLCR
Function May play a role in spermatogenesis. May be involved in synaptic processes.
Tissue Specificity Expressed specifically in testis.

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Biomarker [1]
Breast cancer DIS7DPX1 Strong Biomarker [2]
Breast carcinoma DIS2UE88 Strong Biomarker [2]
Head and neck cancer DISBPSQZ Strong Biomarker [3]
Head and neck carcinoma DISOU1DS Strong Biomarker [3]
Head-neck squamous cell carcinoma DISF7P24 Strong Altered Expression [4]
Pancreatic cancer DISJC981 Strong Genetic Variation [1]
Neoplasm DISZKGEW Disputed Altered Expression [5]
Invasive breast carcinoma DISANYTW Limited Biomarker [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of MYCBP-associated protein (MYCBPAP). [7]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of MYCBP-associated protein (MYCBPAP). [9]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of MYCBP-associated protein (MYCBPAP). [10]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of MYCBP-associated protein (MYCBPAP). [8]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of MYCBP-associated protein (MYCBPAP). [11]
------------------------------------------------------------------------------------

References

1 ARF6 and AMAP1 are major targets of KRAS and TP53 mutations to promote invasion, PD-L1 dynamics, and immune evasion of pancreatic cancer.Proc Natl Acad Sci U S A. 2019 Aug 27;116(35):17450-17459. doi: 10.1073/pnas.1901765116. Epub 2019 Aug 9.
2 CCL18-dependent translocation of AMAP1 is critical for epithelial to mesenchymal transition in breast cancer.J Cell Physiol. 2018 Apr;233(4):3207-3217. doi: 10.1002/jcp.26164. Epub 2017 Sep 27.
3 Inhibition of epithelial-mesenchymal transition by cetuximab via the EGFR-GEP100-Arf6-AMAP1 pathway in head and neck cancer.Head Neck. 2017 Mar;39(3):476-485. doi: 10.1002/hed.24626. Epub 2016 Nov 23.
4 High level expression of AMAP1 protein correlates with poor prognosis and survival after surgery of head and neck squamous cell carcinoma patients.Cell Commun Signal. 2014 Mar 12;12:17. doi: 10.1186/1478-811X-12-17.
5 ArfGAP family proteins in cell adhesion, migration and tumor invasion.Curr Opin Cell Biol. 2006 Oct;18(5):558-64. doi: 10.1016/j.ceb.2006.08.002. Epub 2006 Aug 9.
6 Targeting AMAP1 and cortactin binding bearing an atypical src homology 3/proline interface for prevention of breast cancer invasion and metastasis.Proc Natl Acad Sci U S A. 2006 May 2;103(18):7036-41. doi: 10.1073/pnas.0509166103. Epub 2006 Apr 24.
7 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
8 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
9 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
11 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.