Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT528IZO)

DOT Name GTPase ERas (ERAS)
Synonyms E-Ras; EC 3.6.5.2; Embryonic stem cell-expressed Ras
Gene Name ERAS
Related Disease
Angiosarcoma ( )
Epithelial neoplasm ( )
Lung neoplasm ( )
Advanced cancer ( )
Breast cancer ( )
Breast neoplasm ( )
Epithelial ovarian cancer ( )
Esophageal squamous cell carcinoma ( )
Ileus ( )
Inflammatory bowel disease ( )
Lung cancer ( )
Lung carcinoma ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Analgesia ( )
Breast carcinoma ( )
Neoplasm ( )
Neoplasm of esophagus ( )
Stomach cancer ( )
Venous thromboembolism ( )
UniProt ID
RASE_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
3.6.5.2
Pfam ID
PF00071
Sequence
MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQ
LNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVF
ALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVET
SAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGCSVA
Function Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the tumor-like growth properties of embryonic stem cells.

Molecular Interaction Atlas (MIA) of This DOT

20 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Angiosarcoma DISIYS9W Definitive Biomarker [1]
Epithelial neoplasm DIS0T594 Definitive Biomarker [1]
Lung neoplasm DISVARNB Definitive Biomarker [1]
Advanced cancer DISAT1Z9 Strong Biomarker [2]
Breast cancer DIS7DPX1 Strong Biomarker [3]
Breast neoplasm DISNGJLM Strong Altered Expression [3]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [4]
Esophageal squamous cell carcinoma DIS5N2GV Strong Genetic Variation [5]
Ileus DISH7JW9 Strong Biomarker [6]
Inflammatory bowel disease DISGN23E Strong Biomarker [6]
Lung cancer DISCM4YA Strong Biomarker [7]
Lung carcinoma DISTR26C Strong Biomarker [7]
Ovarian cancer DISZJHAP Strong Biomarker [4]
Ovarian neoplasm DISEAFTY Strong Biomarker [4]
Analgesia DISK3TVI Limited Biomarker [8]
Breast carcinoma DIS2UE88 Limited Altered Expression [9]
Neoplasm DISZKGEW Limited Biomarker [3]
Neoplasm of esophagus DISOLKAQ Limited Biomarker [10]
Stomach cancer DISKIJSX Limited Biomarker [11]
Venous thromboembolism DISUR7CR Limited Biomarker [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 20 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of GTPase ERas (ERAS). [13]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of GTPase ERas (ERAS). [14]
------------------------------------------------------------------------------------

References

1 Susceptibility of transgenic mice carrying human prototype c-Ha-ras gene in a short-term carcinogenicity study of vinyl carbamate and ras gene analyses of the induced tumors.Mol Carcinog. 1997 Nov;20(3):298-307. doi: 10.1002/(sici)1098-2744(199711)20:3<298::aid-mc6>3.0.co;2-h.
2 Effect of intrathecal morphine and epidural analgesia on postoperative recovery after abdominal surgery for gynecologic malignancy: an open-label randomised trial.BMJ Open. 2019 Mar 4;9(3):e024484. doi: 10.1136/bmjopen-2018-024484.
3 The Ras-related gene ERAS is involved in human and murine breast cancer.Sci Rep. 2018 Aug 29;8(1):13038. doi: 10.1038/s41598-018-31326-4.
4 Enhanced Recovery After Surgery for Suspected Ovarian Malignancy: A Survey of Perioperative Practice Among Gynecologic Oncologists in Australia and New Zealand to Inform a Clinical Trial.Int J Gynecol Cancer. 2017 Jun;27(5):1046-1050. doi: 10.1097/IGC.0000000000000982.
5 Association of high-dose postoperative opioids with recurrence risk in esophageal squamous cell carcinoma: reinterpreting ERAS protocols for long-term oncologic surgery outcomes.Dis Esophagus. 2017 Oct 1;30(10):1-8. doi: 10.1093/dote/dox074.
6 Increased incidence of prolonged ileus after colectomy for inflammatory bowel diseases under ERAS protocol: a cohort analysis.J Surg Res. 2017 May 15;212:86-93. doi: 10.1016/j.jss.2016.12.031. Epub 2016 Dec 29.
7 Enhanced recovery after surgery and video-assisted thoracic surgery lobectomy: the Italian VATS Group surgical protocol.J Thorac Dis. 2018 Mar;10(Suppl 4):S564-S570. doi: 10.21037/jtd.2018.01.157.
8 Enhanced recovery after esophageal resection.Cir Esp (Engl Ed). 2018 Aug-Sep;96(7):401-409. doi: 10.1016/j.ciresp.2018.02.010. Epub 2018 Mar 21.
9 Insertional mutagenesis in a HER2-positive breast cancer model reveals ERAS as a driver of cancer and therapy resistance.Oncogene. 2018 Mar;37(12):1594-1609. doi: 10.1038/s41388-017-0031-0. Epub 2018 Jan 12.
10 A novel rasH2 mouse carcinogenesis model that is highly susceptible to 4-NQO-induced tongue and esophageal carcinogenesis is useful for preclinical chemoprevention studies.Carcinogenesis. 2008 Feb;29(2):418-26. doi: 10.1093/carcin/bgm225. Epub 2008 Jan 3.
11 Is ERAS effective and safe in laparoscopic gastrectomy for gastric carcinoma? A meta-analysis.World J Surg Oncol. 2018 Jan 26;16(1):17. doi: 10.1186/s12957-018-1309-6.
12 ERAS: Safety checklists, antibiotics, and VTE prophylaxis.J Surg Oncol. 2017 Oct;116(5):601-607. doi: 10.1002/jso.24790. Epub 2017 Aug 28.
13 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
14 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.