Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT65DTBD)

• DOT Name: Transmembrane protein 170A (TMEM170A)
• Gene Name: TMEM170A
• Related Disease:
  Coronary atherosclerosis
  Coronary heart disease
• UniProt ID: T170A_HUMAN
• Pfam ID: PF10190
• Sequence:
  MEREGSGGSGGSAGLLQQILSLKVVPRVGNGTLCPNSTSLCSFPEMWYGVFLWALVSSLF
  FHVPAGLLALFTLRHHKYGRFMSVSILLMGIVGPITAGILTSAAIAGVYRAAGKEMIPFE
  ALTLGTGQTFCVLVVSFLRILATL
• Function: Acts as a regulator of endoplasmic reticulum (ER) and nuclear envelope (NE) morphogenesis. Affects the ratio between tubular ER and ER sheets by promoting sheet formation at the expense of tubules. Influences NE expansion, nuclear pore complex formation and proper localization of inner nuclear membrane proteins.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Coronary atherosclerosis	DISKNDYU	Limited	Genetic Variation	[1]
Coronary heart disease	DIS5OIP1	Limited	Genetic Variation	[1]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Transmembrane protein 170A (TMEM170A).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Transmembrane protein 170A (TMEM170A).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Transmembrane protein 170A (TMEM170A).	[4]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Transmembrane protein 170A (TMEM170A).	[5]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Transmembrane protein 170A (TMEM170A).	[6]
GALLICACID	DM6Y3A0	Investigative	GALLICACID increases the expression of Transmembrane protein 170A (TMEM170A).	[8]
Resorcinol	DMM37C0	Investigative	Resorcinol decreases the expression of Transmembrane protein 170A (TMEM170A).	[9]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Transmembrane protein 170A (TMEM170A).	[7]

References

• [1] Functional Analysis of a Carotid Intima-Media Thickness Locus Implicates BCAR1 and Suggests a Causal Variant.Circ Cardiovasc Genet. 2015 Oct;8(5):696-706. doi: 10.1161/CIRCGENETICS.115.001062. Epub 2015 Aug 14.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [6] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [7] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [8] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.
• [9] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.