Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT680561)

DOT Name	Polyubiquitin-B
Gene Name	UBB
Related Disease	Isolated cleft palate ( )
UniProt ID	UBB_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	2KHW ; 2MBB ; 2MRO ; 2MSG ; 2N13 ; 4UEL ; 4UF6 ; 4WHV ; 4WLR ; 4WUR ; 4XOF ; 4ZFR ; 4ZFT ; 4ZPZ ; 4ZUX ; 5BNB ; 5CAW ; 5CRA ; 5CVM ; 5CVN ; 5CVO ; 5D0K ; 5D0M ; 5DFL ; 5DK8 ; 5E6J ; 5EDV ; 5EMZ ; 5EYA ; 5GJQ ; 5GO7 ; 5GO8 ; 5GOB ; 5GOC ; 5GOD ; 5GOG ; 5GOH ; 5GOI ; 5GOJ ; 5GOK ; 5H7S ; 5IBK ; 5IFR ; 5JBY ; 5JG6 ; 5JP3 ; 5JTJ ; 5JTV ; 5K9P ; 5KGF ; 5KHY ; 5KYC ; 5KYD ; 5KYE ; 5KYF ; 5L8H ; 5L8W ; 5L9T ; 5LN1 ; 5LRV ; 5LRW ; 5LRX ; 5M93 ; 5MNJ ; 5N2W ; 5N38 ; 5NL5 ; 5NLJ ; 5NVG ; 5O44 ; 5O6T ; 5OHK ; 5OHL ; 5OHN ; 5OHP ; 5TOF ; 5TOG ; 5TUT ; 5TXK ; 5UJL ; 5UJN ; 5ULF ; 5ULH ; 5ULK ; 5V1Y ; 5V1Z ; 5VEY ; 5VF0 ; 5VNZ ; 5VO0 ; 5VZM ; 5VZW ; 5W46 ; 5WFI ; 5X3M ; 5X3N ; 5X3O ; 5XBO ; 5XDP ; 5XK4 ; 5XK5 ; 5XPK ; 5YDR ; 5YIJ ; 5YIK ; 5YMY ; 5YT6 ; 5ZBU ; 5ZD0 ; 6ASR ; 6BVA ; 6BYH ; 6C16 ; 6CP2 ; 6DGF ; 6EI1 ; 6FDK ; 6FGE ; 6FTX ; 6FX4 ; 6FYH ; 6GLC ; 6GZS ; 6H4H ; 6HEI ; 6HEK ; 6IF1 ; 6ISU ; 6JB6 ; 6JB7 ; 6JMA ; 6K4I ; 6K9P ; 6KOW ; 6KOX ; 6LP2 ; 6MSB ; 6MSD ; 6MSE ; 6MSG ; 6N13 ; 6NJ9 ; 6NJG ; 6O96 ; 6OAM ; 6PGV ; 6PZV ; 6QF8 ; 6QK9 ; 6QML ; 6TBM ; 6UH5 ; 6XAA ; 6XQC ; 6XZ1 ; 7AY2 ; 7BBD ; 7BU0 ; 7CAP ; 7DNI ; 7DNJ ; 7E8I ; 7F7X ; 7JMS ; 7LYC ; 7M2K ; 7MC9 ; 7MEY ; 7MYF ; 7MYH ; 7NBB ; 7NPO ; 7OJE ; 7OJX ; 7QO4 ; 7QO5 ; 7RBR ; 7RMA ; 7UD5 ; 7US1 ; 7UV5 ; 7W38 ; 7W39 ; 7W3A ; 7W3B ; 7W3C ; 7W3F ; 7W3G ; 7W3H ; 7W3I ; 7W3J ; 7W3K ; 7W3M ; 7W3U ; 7W54 ; 7XCR ; 7XCT ; 7YQK ; 8A67 ; 8BS9 ; 8C07 ; 8DMQ ; 8DMS ; 8DU4 ; 8EFW ; 8EFX ; 8EHO ; 8GRM ; 8H1T ; 8IC9 ; 8OYP
Pfam ID	PF00240
Sequence	MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC
Function	[Ubiquitin]: Exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-6-linked may be involved in DNA repair; Lys-11-linked is involved in ERAD (endoplasmic reticulum-associated degradation) and in cell-cycle regulation; Lys-29-linked is involved in proteotoxic stress response and cell cycle; Lys-33-linked is involved in kinase modification; Lys-48-linked is involved in protein degradation via the proteasome; Lys-63-linked is involved in endocytosis, DNA-damage responses as well as in signaling processes leading to activation of the transcription factor NF-kappa-B. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling.
KEGG Pathway	Ubiquitin mediated proteolysis (hsa04120 ) Mitophagy - animal (hsa04137 ) Autophagy - animal (hsa04140 ) Parkinson disease (hsa05012 ) Pathways of neurodegeneration - multiple diseases (hsa05022 ) Shigellosis (hsa05131 ) Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
Reactome Pathway	Recognition of DNA damage by PCNA-containing replication complex (R-HSA-110314 ) Translesion Synthesis by POLH (R-HSA-110320 ) Activation of NF-kappaB in B cells (R-HSA-1169091 ) ISG15 antiviral mechanism (R-HSA-1169408 ) Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha (R-HSA-1234176 ) Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants (R-HSA-1236382 ) ER-Phagosome pathway (R-HSA-1236974 ) Downregulation of ERBB4 signaling (R-HSA-1253288 ) Spry regulation of FGF signaling (R-HSA-1295596 ) Downregulation of ERBB2 (R-HSA-1358803 ) Budding and maturation of HIV virion (R-HSA-162588 ) NOD1/2 Signaling Pathway (R-HSA-168638 ) TICAM1, RIP1-mediated IKK complex recruitment (R-HSA-168927 ) DDX58/IFIH1-mediated induction of interferon-alpha/beta (R-HSA-168928 ) APC/C (R-HSA-174048 ) Autodegradation of Cdh1 by Cdh1 (R-HSA-174084 ) SCF-beta-TrCP mediated degradation of Emi1 (R-HSA-174113 ) APC/C (R-HSA-174154 ) APC/C (R-HSA-174178 ) Cdc20 (R-HSA-174184 ) Membrane binding and targetting of GAG proteins (R-HSA-174490 ) Assembly Of The HIV Virion (R-HSA-175474 ) APC-Cdc20 mediated degradation of Nek2A (R-HSA-179409 ) Vpu mediated degradation of CD4 (R-HSA-180534 ) Vif-mediated degradation of APOBEC3G (R-HSA-180585 ) EGFR downregulation (R-HSA-182971 ) SCF(Skp2)-mediated degradation of p27/p21 (R-HSA-187577 ) Degradation of beta-catenin by the destruction complex (R-HSA-195253 ) TCF dependent signaling in response to WNT (R-HSA-201681 ) Downstream TCR signaling (R-HSA-202424 ) NRIF signals cell death from the nucleus (R-HSA-205043 ) p75NTR recruits signalling complexes (R-HSA-209543 ) NF-kB is activated and signals survival (R-HSA-209560 ) Regulation of activated PAK-2p34 by proteasome mediated degradation (R-HSA-211733 ) NOTCH1 Intracellular Domain Regulates Transcription (R-HSA-2122947 ) Activated NOTCH1 Transmits Signal to the Nucleus (R-HSA-2122948 ) Downregulation of TGF-beta receptor signaling (R-HSA-2173788 ) TGF-beta receptor signaling in EMT (epithelial to mesenchymal transition) (R-HSA-2173791 ) Downregulation of SMAD2/3 (R-HSA-2173795 ) SMAD2/SMAD3 (R-HSA-2173796 ) Separation of Sister Chromatids (R-HSA-2467813 ) Oxidative Stress Induced Senescence (R-HSA-2559580 ) Senescence-Associated Secretory Phenotype (SASP) (R-HSA-2559582 ) Oncogene Induced Senescence (R-HSA-2559585 ) Regulation of PLK1 Activity at G2/M Transition (R-HSA-2565942 ) Constitutive Signaling by NOTCH1 PEST Domain Mutants (R-HSA-2644606 ) Stimuli-sensing channels (R-HSA-2672351 ) Constitutive Signaling by NOTCH1 HD Domain Mutants (R-HSA-2691232 ) FCERI mediated NF-kB activation (R-HSA-2871837 ) Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants (R-HSA-2894862 ) NOTCH2 Activation and Transmission of Signal to the Nucleus (R-HSA-2979096 ) Regulation of innate immune responses to cytosolic DNA (R-HSA-3134975 ) Glycogen synthesis (R-HSA-3322077 ) Autodegradation of the E3 ubiquitin ligase COP1 (R-HSA-349425 ) Deactivation of the beta-catenin transactivating complex (R-HSA-3769402 ) Myoclonic epilepsy of Lafora (R-HSA-3785653 ) ABC-family proteins mediated transport (R-HSA-382556 ) Circadian Clock (R-HSA-400253 ) TAK1-dependent IKK and NF-kappa-B activation (R-HSA-445989 ) activated TAK1 mediates p38 MAPK activation (R-HSA-450302 ) JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1 (R-HSA-450321 ) AUF1 (hnRNP D0) binds and destabilizes mRNA (R-HSA-450408 ) Asymmetric localization of PCP proteins (R-HSA-4608870 ) Degradation of AXIN (R-HSA-4641257 ) Degradation of DVL (R-HSA-4641258 ) Regulation of FZD by ubiquitination (R-HSA-4641263 ) PINK1-PRKN Mediated Mitophagy (R-HSA-5205685 ) N-glycan trimming in the ER and Calnexin/Calreticulin cycle (R-HSA-532668 ) Regulation of TNFR1 signaling (R-HSA-5357905 ) TNFR1-induced NF-kappa-B signaling pathway (R-HSA-5357956 ) Hedgehog ligand biogenesis (R-HSA-5358346 ) Hh mutants are degraded by ERAD (R-HSA-5362768 ) Dectin-1 mediated noncanonical NF-kB signaling (R-HSA-5607761 ) CLEC7A (Dectin-1) signaling (R-HSA-5607764 ) Degradation of GLI1 by the proteasome (R-HSA-5610780 ) Degradation of GLI2 by the proteasome (R-HSA-5610783 ) GLI3 is processed to GLI3R by the proteasome (R-HSA-5610785 ) Hedgehog 'on' state (R-HSA-5632684 ) Negative regulation of FGFR1 signaling (R-HSA-5654726 ) Negative regulation of FGFR2 signaling (R-HSA-5654727 ) Negative regulation of FGFR3 signaling (R-HSA-5654732 ) Negative regulation of FGFR4 signaling (R-HSA-5654733 ) Translesion synthesis by POLK (R-HSA-5655862 ) Translesion synthesis by POLI (R-HSA-5656121 ) Termination of translesion DNA synthesis (R-HSA-5656169 ) Regulation of RAS by GAPs (R-HSA-5658442 ) TNFR2 non-canonical NF-kB pathway (R-HSA-5668541 ) Negative regulation of MAPK pathway (R-HSA-5675221 ) Regulation of necroptotic cell death (R-HSA-5675482 ) NIK-->noncanonical NF-kB signaling (R-HSA-5676590 ) Defective CFTR causes cystic fibrosis (R-HSA-5678895 ) MAP3K8 (TPL2)-dependent MAPK1/3 activation (R-HSA-5684264 ) HDR through Homologous Recombination (HRR) (R-HSA-5685942 ) MAPK6/MAPK4 signaling (R-HSA-5687128 ) UCH proteinases (R-HSA-5689603 ) Josephin domain DUBs (R-HSA-5689877 ) Ub-specific processing proteases (R-HSA-5689880 ) Ovarian tumor domain proteases (R-HSA-5689896 ) Metalloprotease DUBs (R-HSA-5689901 ) Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks (R-HSA-5693565 ) Processing of DNA double-strand break ends (R-HSA-5693607 ) DNA Damage Recognition in GG-NER (R-HSA-5696394 ) Formation of Incision Complex in GG-NER (R-HSA-5696395 ) Gap-filling DNA repair synthesis and ligation in GG-NER (R-HSA-5696397 ) Dual Incision in GG-NER (R-HSA-5696400 ) Formation of TC-NER Pre-Incision Complex (R-HSA-6781823 ) Transcription-Coupled Nucleotide Excision Repair (TC-NER) (R-HSA-6781827 ) Dual incision in TC-NER (R-HSA-6782135 ) Gap-filling DNA repair synthesis and ligation in TC-NER (R-HSA-6782210 ) Fanconi Anemia Pathway (R-HSA-6783310 ) Regulation of TP53 Activity through Phosphorylation (R-HSA-6804756 ) Regulation of TP53 Degradation (R-HSA-6804757 ) Regulation of TP53 Activity through Methylation (R-HSA-6804760 ) Negative regulation of MET activity (R-HSA-6807004 ) Assembly of the pre-replicative complex (R-HSA-68867 ) Orc1 removal from chromatin (R-HSA-68949 ) CDK-mediated phosphorylation and removal of Cdc6 (R-HSA-69017 ) Cyclin D associated events in G1 (R-HSA-69231 ) G2/M Checkpoints (R-HSA-69481 ) Stabilization of p53 (R-HSA-69541 ) Ubiquitin Mediated Degradation of Phosphorylated Cdc25A (R-HSA-69601 ) Ubiquitin-dependent degradation of Cyclin D (R-HSA-75815 ) PTK6 Regulates RTKs and Their Effectors AKT1 and DOK1 (R-HSA-8849469 ) The role of GTSE1 in G2/M progression after G2 checkpoint (R-HSA-8852276 ) FBXL7 down-regulates AURKA during mitotic entry and in early mitosis (R-HSA-8854050 ) Cargo recognition for clathrin-mediated endocytosis (R-HSA-8856825 ) Clathrin-mediated endocytosis (R-HSA-8856828 ) Downregulation of ERBB2 signaling (R-HSA-8863795 ) VLDLR internalisation and degradation (R-HSA-8866427 ) Synthesis of active ubiquitin (R-HSA-8866652 ) E3 ubiquitin ligases ubiquitinate target proteins (R-HSA-8866654 ) InlB-mediated entry of Listeria monocytogenes into host cell (R-HSA-8875360 ) InlA-mediated entry of Listeria monocytogenes into host cells (R-HSA-8876493 ) RUNX1 regulates transcription of genes involved in differentiation of HSCs (R-HSA-8939236 ) Regulation of RUNX2 expression and activity (R-HSA-8939902 ) Regulation of RUNX3 expression and activity (R-HSA-8941858 ) Regulation of PTEN localization (R-HSA-8948747 ) Regulation of PTEN stability and activity (R-HSA-8948751 ) Neddylation (R-HSA-8951664 ) ER Quality Control Compartment (ERQC) (R-HSA-901032 ) Regulation of expression of SLITs and ROBOs (R-HSA-9010553 ) NOTCH3 Activation and Transmission of Signal to the Nucleus (R-HSA-9013507 ) TICAM1-dependent activation of IRF3/IRF7 (R-HSA-9013973 ) TICAM1,TRAF6-dependent induction of TAK1 complex (R-HSA-9014325 ) Interleukin-1 signaling (R-HSA-9020702 ) Peroxisomal protein import (R-HSA-9033241 ) Interferon alpha/beta signaling (R-HSA-909733 ) Regulation of signaling by CBL (R-HSA-912631 ) Endosomal Sorting Complex Required For Transport (ESCRT) (R-HSA-917729 ) Iron uptake and transport (R-HSA-917937 ) Negative regulators of DDX58/IFIH1 signaling (R-HSA-936440 ) Activation of IRF3, IRF7 mediated by TBK1, IKK (IKBKE) (R-HSA-936964 ) IRAK1 recruits IKK complex (R-HSA-937039 ) IKK complex recruitment mediated by RIP1 (R-HSA-937041 ) IRAK2 mediated activation of TAK1 complex (R-HSA-937042 ) TRAF6-mediated induction of TAK1 complex within TLR4 complex (R-HSA-937072 ) Negative regulation of NOTCH4 signaling (R-HSA-9604323 ) Chaperone Mediated Autophagy (R-HSA-9613829 ) Late endosomal microautophagy (R-HSA-9615710 ) Prevention of phagosomal-lysosomal fusion (R-HSA-9636383 ) Modulation by Mtb of host immune system (R-HSA-9637628 ) Alpha-protein kinase 1 signaling pathway (R-HSA-9645460 ) Aggrephagy (R-HSA-9646399 ) RAS processing (R-HSA-9648002 ) Pexophagy (R-HSA-9664873 ) Signaling by CSF1 (M-CSF) in myeloid cells (R-HSA-9680350 ) Maturation of protein E (R-HSA-9683683 ) SARS-CoV-1 activates/modulates innate immune responses (R-HSA-9692916 ) Maturation of protein E (R-HSA-9694493 ) Inactivation of CSF3 (G-CSF) signaling (R-HSA-9705462 ) SARS-CoV-2 activates/modulates innate and adaptive immune responses (R-HSA-9705671 ) Negative regulation of FLT3 (R-HSA-9706369 ) FLT3 signaling by CBL mutants (R-HSA-9706377 ) Regulation of BACH1 activity (R-HSA-9708530 ) TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling (R-HSA-975110 ) IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation (R-HSA-975144 ) IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation (R-HSA-975163 ) KEAP1-NFE2L2 pathway (R-HSA-9755511 ) Regulation of NF-kappa B signaling (R-HSA-9758274 ) GSK3B and BTRC (R-HSA-9762114 ) Amyloid fiber formation (R-HSA-977225 ) Antigen processing (R-HSA-983168 ) Translesion synthesis by REV1 (R-HSA-110312 )
BioCyc Pathway	MetaCyc:ENSG00000170315-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Isolated cleft palate	DISV80CD	No Known	Autosomal dominant	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Polyubiquitin-B .	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Polyubiquitin-B .	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Polyubiquitin-B .	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate affects the expression of Polyubiquitin-B .	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Polyubiquitin-B .	[6]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Polyubiquitin-B .	[7]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Polyubiquitin-B .	[8]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Polyubiquitin-B .	[9]
Enzalutamide	DMGL19D	Approved	Enzalutamide affects the expression of Polyubiquitin-B .	[10]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Polyubiquitin-B .	[12]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Polyubiquitin-B .	[13]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Polyubiquitin-B .	[14]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Polyubiquitin-B .	[15]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Polyubiquitin-B .	[16]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of Polyubiquitin-B .	[17]
------------------------------------------------------------------------------------


⏷ Show the Full List of 15 Drug(s)

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Polyubiquitin-B .	[11]
------------------------------------------------------------------------------------

References

1	The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
2	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3	Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
4	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6	Nuclear proteome analysis of cisplatin-treated HeLa cells. Mutat Res. 2010 Sep 10;691(1-2):1-8. doi: 10.1016/j.mrfmmm.2010.06.002. Epub 2010 Jun 9.
7	Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
8	Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
9	Cannabidiol Modulates the Expression of Alzheimer's Disease-Related Genes in Mesenchymal Stem Cells. Int J Mol Sci. 2016 Dec 23;18(1):26. doi: 10.3390/ijms18010026.
10	NOTCH signaling is activated in and contributes to resistance in enzalutamide-resistant prostate cancer cells. J Biol Chem. 2019 May 24;294(21):8543-8554. doi: 10.1074/jbc.RA118.006983. Epub 2019 Apr 2.
11	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
12	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
13	Bisphenol-A and estradiol exert novel gene regulation in human MCF-7 derived breast cancer cells. Mol Cell Endocrinol. 2004 Jun 30;221(1-2):47-55. doi: 10.1016/j.mce.2004.04.010.
14	Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
15	Inhibition of CXCL12-mediated chemotaxis of Jurkat cells by direct immunotoxicants. Arch Toxicol. 2016 Jul;90(7):1685-94. doi: 10.1007/s00204-015-1585-7. Epub 2015 Aug 28.
16	Inhibition of Protein Ubiquitination by Paraquat and 1-Methyl-4-Phenylpyridinium Impairs Ubiquitin-Dependent Protein Degradation Pathways. Mol Neurobiol. 2016 Oct;53(8):5229-51. doi: 10.1007/s12035-015-9414-9. Epub 2015 Sep 26.
17	Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.