Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6AQNY8)

• DOT Name: Transmembrane protein 91 (TMEM91)
• Synonyms: Dispanin subfamily C member 3; DSPC3
• Gene Name: TMEM91
• UniProt ID: TMM91_HUMAN
• Pfam ID: PF04505
• Sequence:
  MDSPSLRELQQPLLEGTECETPAQKPGRHELGSPLREIAFAESLRGLQFLSPPLPSVSAG
  LGEPRPPDVEDMSSSDSDSDWDGGSRLSPFLPHDHLGLAVFSMLCCFWPVGIAAFCLAQK
  TNKAWAKGDIQGAGAASRRAFLLGVLAVGLGVCTYAAALVTLAAYLASRDPP

Molecular Interaction Atlas (MIA) of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Transmembrane protein 91 (TMEM91).	[1]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Transmembrane protein 91 (TMEM91).	[2]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Transmembrane protein 91 (TMEM91).	[3]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Transmembrane protein 91 (TMEM91).	[4]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Transmembrane protein 91 (TMEM91).	[2]
Pioglitazone	DMKJ485	Approved	Pioglitazone increases the expression of Transmembrane protein 91 (TMEM91).	[5]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Transmembrane protein 91 (TMEM91).	[8]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Transmembrane protein 91 (TMEM91).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Transmembrane protein 91 (TMEM91).	[7]

References

• [1] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [2] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [3] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [4] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [5] Peroxisome proliferator activated receptor gamma (PPAR-gama) ligand pioglitazone regulated gene networks in term human primary trophoblast cells. Reprod Toxicol. 2018 Oct;81:99-107.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Expression and DNA methylation changes in human breast epithelial cells after bisphenol A exposure. Int J Oncol. 2012 Jul;41(1):369-77.
• [8] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.