Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6CRQ67)

• DOT Name: Ankyrin repeat domain-containing protein 22 (ANKRD22)
• Gene Name: ANKRD22
• Related Disease:
  Neoplasm
  Non-small-cell lung cancer
  Prostate cancer
  Prostate carcinoma
• UniProt ID: ANR22_HUMAN
• Pfam ID: PF12796
• Sequence:
  MGILYSEPICQAAYQNDFGQVWRWVKEDSSYANVQDGFNGDTPLICACRRGHVRIVSFLL
  RRNANVNLKNQKERTCLHYAVKKKFTFIDYLLIILLMPVLLIGYFLMVSKTKQNEALVRM
  LLDAGVEVNATDCYGCTALHYACEMKNQSLIPLLLEARADPTIKNKHGESSLDIARRLKF
  SQIELMLRKAL

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Strong	Altered Expression	[1]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[1]
Prostate cancer	DISF190Y	Strong	Altered Expression	[2]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[2]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Ankyrin repeat domain-containing protein 22 (ANKRD22).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Ankyrin repeat domain-containing protein 22 (ANKRD22).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Ankyrin repeat domain-containing protein 22 (ANKRD22).	[5]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Ankyrin repeat domain-containing protein 22 (ANKRD22).	[6]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Ankyrin repeat domain-containing protein 22 (ANKRD22).	[6]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Ankyrin repeat domain-containing protein 22 (ANKRD22).	[7]
Cholecalciferol	DMGU74E	Approved	Cholecalciferol affects the expression of Ankyrin repeat domain-containing protein 22 (ANKRD22).	[8]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of Ankyrin repeat domain-containing protein 22 (ANKRD22).	[9]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Ankyrin repeat domain-containing protein 22 (ANKRD22).	[11]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Ankyrin repeat domain-containing protein 22 (ANKRD22).	[13]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Ankyrin repeat domain-containing protein 22 (ANKRD22).	[14]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Ankyrin repeat domain-containing protein 22 (ANKRD22).	[10]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Ankyrin repeat domain-containing protein 22 (ANKRD22).	[12]

References

• [1] ANKRD22 promotes progression of non-small cell lung cancer through transcriptional up-regulation of E2F1.Sci Rep. 2017 Jun 30;7(1):4430. doi: 10.1038/s41598-017-04818-y.
• [2] ANKRD22 is involved in the progression of prostate cancer.Oncol Lett. 2019 Oct;18(4):4106-4113. doi: 10.3892/ol.2019.10738. Epub 2019 Aug 9.
• [3] Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
• [4] Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
• [5] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [6] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [7] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [8] Targeting iron homeostasis induces cellular differentiation and synergizes with differentiating agents in acute myeloid leukemia. J Exp Med. 2010 Apr 12;207(4):731-50. doi: 10.1084/jem.20091488. Epub 2010 Apr 5.
• [9] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [12] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [13] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [14] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.