Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6GWBAF)

DOT Name Immunoglobulin superfamily member 3 (IGSF3)
Synonyms IgSF3; Glu-Trp-Ile EWI motif-containing protein 3; EWI-3
Gene Name IGSF3
Related Disease
Interstitial nephritis ( )
Primary systemic amyloidosis ( )
Familial congenital nasolacrimal duct obstruction ( )
Intellectual disability ( )
UniProt ID
IGSF3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF07686
Sequence
MKCFFPVLSCLAVLGVVSAQRQVTVQEGPLYRTEGSHITIWCNVSGYQGPSEQNFQWSIY
LPSSPEREVQIVSTMDSSFPYAIYTQRVRGGKIFIERVQGNSTLLHITDLQARDAGEYEC
HTPSTDKQYFGSYSAKMNLVVIPDSLQTTAMPQTLHRVEQDPLELTCEVASETIQHSHLS
VAWLRQKVGEKPVEVISLSRDFMLHSSSEYAQRQSLGEVRLDKLGRTTFRLTIFHLQPSD
QGEFYCEAAEWIQDPDGSWYAMTRKRSEGAVVNVQPTDKEFTVRLETEKRLHTVGEPVEF
RCILEAQNVPDRYFAVSWAFNSSLIATMGPNAVPVLNSEFAHREARGQLKVAKESDSVFV
LKIYHLRQEDSGKYNCRVTEREKTVTGEFIDKESKRPKNIPIIVLPLKSSISVEVASNAS
VILEGEDLRFSCSVRTAGRPQGRFSVIWQLVDRQNRRSNIMWLDRDGTVQPGSSYWERSS
FGGVQMEQVQPNSFSLGIFNSRKEDEGQYECHVTEWVRAVDGEWQIVGERRASTPISITA
LEMGFAVTAISRTPGVTYSDSFDLQCIIKPHYPAWVPVSVTWRFQPVGTVEFHDLVTFTR
DGGVQWGDRSSSFRTRTAIEKAESSNNVRLSISRASDTEAGKYQCVAELWRKNYNNTWTR
LAERTSNLLEIRVLQPVTKLQVSKSKRTLTLVENKPIQLNCSVKSQTSQNSHFAVLWYVH
KPSDADGKLILKTTHNSAFEYGTYAEEEGLRARLQFERHVSGGLFSLTVQRAEVSDSGSY
YCHVEEWLLSPNYAWYKLAEEVSGRTEVTVKQPDSRLRLSQAQGNLSVLETRQVQLECVV
LNRTSITSQLMVEWFVWKPNHPERETVARLSRDATFHYGEQAAKNNLKGRLHLESPSPGV
YRLFIQNVAVQDSGTYSCHVEEWLPSPSGMWYKRAEDTAGQTALTVMRPDASLQVDTVVP
NATVSEKAAFQLDCSIVSRSSQDSRFAVAWYSLRTKAGGKRSSPGLEEQEEEREEEEEED
DDDDDDPTERTALLSVGPDAVFGPEGSPWEGRLRFQRLSPVLYRLTVLQASPQDTGNYSC
HVEEWLPSPQKEWYRLTEEESAPIGIRVLDTSPTLQSIICSNDALFYFVFFYPFPIFGIL
IITILLVRFKSRNSSKNSDGKNGVPLLWIKEPHLNYSPTCLEPPVLSIHPGAID
Tissue Specificity Expressed in a wide range of tissues with High expression in Placenta, kidney and lung.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Interstitial nephritis DISKQGND Strong Biomarker [1]
Primary systemic amyloidosis DISIALGI moderate Biomarker [2]
Familial congenital nasolacrimal duct obstruction DISK5JE2 Supportive Autosomal recessive [3]
Intellectual disability DISMBNXP Disputed Genetic Variation [4]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Immunoglobulin superfamily member 3 (IGSF3). [5]
Ciclosporin DMAZJFX Approved Ciclosporin increases the methylation of Immunoglobulin superfamily member 3 (IGSF3). [6]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Immunoglobulin superfamily member 3 (IGSF3). [13]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Immunoglobulin superfamily member 3 (IGSF3). [15]
------------------------------------------------------------------------------------
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Immunoglobulin superfamily member 3 (IGSF3). [7]
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of Immunoglobulin superfamily member 3 (IGSF3). [8]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Immunoglobulin superfamily member 3 (IGSF3). [9]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Immunoglobulin superfamily member 3 (IGSF3). [10]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Immunoglobulin superfamily member 3 (IGSF3). [11]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Immunoglobulin superfamily member 3 (IGSF3). [8]
Nicotine DMWX5CO Approved Nicotine increases the expression of Immunoglobulin superfamily member 3 (IGSF3). [12]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of Immunoglobulin superfamily member 3 (IGSF3). [14]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Immunoglobulin superfamily member 3 (IGSF3). [16]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)

References

1 Acquired Fanconi syndrome secondary to light chain deposition disease associated with monoclonal gammopathy of renal significance: A case report.Medicine (Baltimore). 2018 Sep;97(36):e12027. doi: 10.1097/MD.0000000000012027.
2 Epidemiological and clinical characteristics and outcome of monoclonal gammopathy of renal significance-related lesions in Latin America.Nephrology (Carlton). 2020 Jun;25(6):442-449. doi: 10.1111/nep.13685. Epub 2019 Dec 19.
3 Identification of an IGSF3 mutation in a family with congenital nasolacrimal duct obstruction. Clin Genet. 2014 Dec;86(6):589-91. doi: 10.1111/cge.12321. Epub 2013 Dec 27.
4 The immunoglobulin-like superfamily member IGSF3 is a developmentally regulated protein that controls neuronal morphogenesis.Dev Neurobiol. 2017 Jan;77(1):75-92. doi: 10.1002/dneu.22412. Epub 2016 Jul 8.
5 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
6 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
7 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
8 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
9 Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
10 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
11 Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
12 Characterizing the genetic basis for nicotine induced cancer development: a transcriptome sequencing study. PLoS One. 2013 Jun 18;8(6):e67252.
13 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
14 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
15 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
16 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.