Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6UGMDV)

• DOT Name: Tetratricopeptide repeat protein 34 (TTC34)
• Synonyms: TPR repeat protein 34
• Gene Name: TTC34
• Related Disease:
  Multiple sclerosis
  Systemic lupus erythematosus
  Autoimmune disease
  Immune system disorder
  Lupus nephritis
• UniProt ID: TTC34_HUMAN
• Pfam ID: PF13432 ; PF13181
• Sequence:
  MLQRSPRAGPSRAQGRREAAETGGPTTQEGVACGVHQLATLLMELDSEDEASRLLAADAL
  YRLGRLEETHKALLVALSRRPQAAPVLARLALLQLRRGFFYDANQLVKKLVQSGDTACLQ
  PTLDVFCHEDRQLLQGHCHARALAILRARPGGADGRVHTKEAIAYLSLAIFAAGSQASES
  LLARARCYGFLGQKKTAMFDFNTVLRAEPGNVQALCGRALVHLALDQLQEAVDDIVSALK
  LGPGTVVPELRSLKPEAQALITQGLYSHCRALLSQLPDTGAPLEDKDTQGLLAVGEALIK
  IDSGQPHWHLLLADILMAQGSYEEAGTHLEKALHRAPTSEAARARLGLLQLKKGDVPGAA
  RDLQSLAEVDAPDLSCLLHLLEASERQSLAQAAAQEAGTLLDAGQPRQALGYCSLSVLAS
  GSSACHLRLRATCLAELQEFGRALRDLDHVLQEALGDGDLPRRAEDFCRQGRLLLSLGDE
  AAAAGAFAQALKLAPSLAQNSLCRQPGRAPTARMFLLRGQCCLEEQRHAEAWTAVESGLL
  VDPDHRGLKRLKARIRREASSGCWLQ

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Multiple sclerosis	DISB2WZI	Strong	Genetic Variation	[1]
Systemic lupus erythematosus	DISI1SZ7	Strong	Genetic Variation	[2]
Autoimmune disease	DISORMTM	moderate	Genetic Variation	[3]
Immune system disorder	DISAEGPH	moderate	Genetic Variation	[3]
Lupus nephritis	DISCVGPZ	moderate	Biomarker	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Tetratricopeptide repeat protein 34 (TTC34).	[5]

References

• [1] Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.Nature. 2011 Aug 10;476(7359):214-9. doi: 10.1038/nature10251.
• [2] Coherent somatic mutation in autoimmune disease.PLoS One. 2014 Jul 2;9(7):e101093. doi: 10.1371/journal.pone.0101093. eCollection 2014.
• [3] Meta-analysis of genome-wide association studies in celiac disease and rheumatoid arthritis identifies fourteen non-HLA shared loci.PLoS Genet. 2011 Feb;7(2):e1002004. doi: 10.1371/journal.pgen.1002004. Epub 2011 Feb 24.
• [4] Genetic contributions to lupus nephritis in a multi-ethnic cohort of systemic lupus erythematous patients.PLoS One. 2018 Jun 28;13(6):e0199003. doi: 10.1371/journal.pone.0199003. eCollection 2018.
• [5] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.