Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT70HMQ5)

• DOT Name: Homeobox protein Hox-A7 (HOXA7)
• Synonyms: Homeobox protein Hox 1.1; Homeobox protein Hox-1A
• Gene Name: HOXA7
• UniProt ID: HXA7_HUMAN
• Pfam ID: PF00046
• Sequence:
  MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFASTVPGLYNVNSP
  LYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGAAEANFRIY
  PWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQN
  RRMKWKKEHKDEGPTAAAAPEGAVPSAAATAAADKADEEDDDEEEEDEEE
• Function: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Molecular Interaction Atlas (MIA) of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Homeobox protein Hox-A7 (HOXA7).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Homeobox protein Hox-A7 (HOXA7).	[2]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Homeobox protein Hox-A7 (HOXA7).	[3]
Phenobarbital	DMXZOCG	Approved	Phenobarbital decreases the expression of Homeobox protein Hox-A7 (HOXA7).	[4]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Homeobox protein Hox-A7 (HOXA7).	[5]
Beta-carotene	DM0RXBT	Approved	Beta-carotene increases the expression of Homeobox protein Hox-A7 (HOXA7).	[6]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Homeobox protein Hox-A7 (HOXA7).	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Homeobox protein Hox-A7 (HOXA7).	[8]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Noncoding RNA synthesis and loss of Polycomb group repression accompanies the colinear activation of the human HOXA cluster. RNA. 2007 Feb;13(2):223-39. doi: 10.1261/rna.266707. Epub 2006 Dec 21.
• [3] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [4] Dose- and time-dependent effects of phenobarbital on gene expression profiling in human hepatoma HepaRG cells. Toxicol Appl Pharmacol. 2009 Feb 1;234(3):345-60.
• [5] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [6] Beta-carotene and apocarotenals promote retinoid signaling in BEAS-2B human bronchioepithelial cells. Arch Biochem Biophys. 2006 Nov 1;455(1):48-60.
• [7] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.