Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT87WEPQ)

• DOT Name: Testis-expressed protein 30 (TEX30)
• Gene Name: TEX30
• Related Disease: Adenoma
• UniProt ID: TEX30_HUMAN
• Pfam ID: PF20408
• Sequence:
  MSHTEVKLKIPFGNKLLDAVCLVPNKSLTYGIILTHGASGDMNLPHLMSLASHLASHGFF
  CLRFTCKGLNIVHRIKAYKSVLNYLKTSGEYKLAGVFLGGRSMGSRAAASVMCHIEPDDG
  DDFVRGLICISYPLHHPKQQHKLRDEDLFRLKEPVLFVSGSADEMCEKNLLEKVAQKMQA
  PHKIHWIEKANHSMAVKGRSTNDVFKEINTQILFWIQEITEMDKKCH

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenoma	DIS78ZEV	Strong	Biomarker	[1]

18 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Testis-expressed protein 30 (TEX30).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Testis-expressed protein 30 (TEX30).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Testis-expressed protein 30 (TEX30).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Testis-expressed protein 30 (TEX30).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Testis-expressed protein 30 (TEX30).	[6]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Testis-expressed protein 30 (TEX30).	[7]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Testis-expressed protein 30 (TEX30).	[8]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Testis-expressed protein 30 (TEX30).	[7]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Testis-expressed protein 30 (TEX30).	[9]
Melphalan	DMOLNHF	Approved	Melphalan increases the expression of Testis-expressed protein 30 (TEX30).	[10]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide decreases the expression of Testis-expressed protein 30 (TEX30).	[11]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Testis-expressed protein 30 (TEX30).	[12]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Testis-expressed protein 30 (TEX30).	[13]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of Testis-expressed protein 30 (TEX30).	[14]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Testis-expressed protein 30 (TEX30).	[3]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Testis-expressed protein 30 (TEX30).	[15]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Testis-expressed protein 30 (TEX30).	[16]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Testis-expressed protein 30 (TEX30).	[17]

References

• [1] Genomic profiling of rectal adenoma and carcinoma by array-based comparative genomic hybridization.BMC Med Genomics. 2012 Nov 16;5:52. doi: 10.1186/1755-8794-5-52.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [6] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [7] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [8] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [9] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [10] Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
• [11] Comparative gene expression analysis of a chronic myelogenous leukemia cell line resistant to cyclophosphamide using oligonucleotide arrays and response to tyrosine kinase inhibitors. Leuk Res. 2007 Nov;31(11):1511-20.
• [12] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [13] Epigallocatechin-3-gallate (EGCG) protects against chromate-induced toxicity in vitro. Toxicol Appl Pharmacol. 2012 Jan 15;258(2):166-75.
• [14] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [15] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [16] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [17] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.