Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT89RKJH)

DOT Name Suprabasin (SBSN)
Gene Name SBSN
Related Disease
Alzheimer disease ( )
Alzheimer disease 3 ( )
Atopic dermatitis ( )
Esophageal squamous cell carcinoma ( )
Lung cancer ( )
Lung carcinoma ( )
Neoplasm ( )
Advanced cancer ( )
Metastatic malignant neoplasm ( )
Ovarian cancer ( )
Aplasia cutis congenita ( )
Corpus callosum, agenesis of ( )
UniProt ID
SBSN_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF21009
Sequence
MHLARLVGSCSLLLLLGALSGWAASDDPIEKVIEGINRGLSNAEREVGKALDGINSGITH
AGREVEKVFNGLSNMGSHTGKELDKGVQGLNHGMDKVAHEINHGIGQAGKEAEKLGHGVN
NAAGQVGKEADKLIHHGVHHGANQAGSEAGKFGQGVDNAAGQAGNEAGRFGQGVHHAAGQ
AGNEAGRFGQGVHHAAGQAGNEAGRFGQGAHHGLSEGWKETEKFGQGIHHAAGQVGKEAE
KFGQGAHHAAGQAGNEAGRFGQGVHHGLSEGWKETEKFGQGVHHTAGQVGKEAEKFGQGA
HHAAGQAGNEAGRFGQGAHHAAGQAGNEAGRFGQGVHHGLSEGWKETEKFGQGVHHAASQ
FGKETEKLGHGVHHGVNEAWKEAEKFGQGVHHAASQVGKEEDRVVQGLHHGVSQAGREAG
QFGHDIHHTAGQAGKEGDIAVHGVQPGVHEAGKEAGQFGQGVHHTLEQAGKEADKAVQGF
HTGVHQAGKEAEKLGQGVNHAADQAGKEVEKLGQGAHHAAGQAGKELQNAHNGVNQASKE
ANQLLNGNHQSGSSSHQGGATTTPLASGASVNTPFINLPALWRSVANIMP
Tissue Specificity Detected in thymus, uterus and esophagus.

Molecular Interaction Atlas (MIA) of This DOT

12 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Alzheimer disease DISF8S70 Strong Biomarker [1]
Alzheimer disease 3 DISVT69G Strong Biomarker [1]
Atopic dermatitis DISTCP41 Strong Biomarker [1]
Esophageal squamous cell carcinoma DIS5N2GV Strong Biomarker [2]
Lung cancer DISCM4YA Strong Altered Expression [3]
Lung carcinoma DISTR26C Strong Altered Expression [3]
Neoplasm DISZKGEW Strong Altered Expression [2]
Advanced cancer DISAT1Z9 Disputed Biomarker [4]
Metastatic malignant neoplasm DIS86UK6 Disputed Altered Expression [4]
Ovarian cancer DISZJHAP Disputed Altered Expression [4]
Aplasia cutis congenita DISMDAYM Limited Biomarker [5]
Corpus callosum, agenesis of DISO9P40 Limited Biomarker [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Suprabasin (SBSN). [6]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the methylation of Suprabasin (SBSN). [7]
------------------------------------------------------------------------------------
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Suprabasin (SBSN). [8]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Suprabasin (SBSN). [9]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Suprabasin (SBSN). [10]
Hexadecanoic acid DMWUXDZ Investigative Hexadecanoic acid increases the expression of Suprabasin (SBSN). [11]
Octanal DMTN0OK Investigative Octanal increases the expression of Suprabasin (SBSN). [12]
------------------------------------------------------------------------------------

References

1 Decreased expression of suprabasin induces aberrant differentiation and apoptosis of epidermal keratinocytes: Possible role for atopic dermatitis.J Dermatol Sci. 2019 Sep;95(3):107-112. doi: 10.1016/j.jdermsci.2019.07.009. Epub 2019 Jul 27.
2 Overexpression of Suprabasin is Associated with Proliferation and Tumorigenicity of Esophageal Squamous Cell Carcinoma.Sci Rep. 2016 Feb 22;6:21549. doi: 10.1038/srep21549.
3 Dose-dependent activation of putative oncogene SBSN by BORIS.PLoS One. 2012;7(7):e40389. doi: 10.1371/journal.pone.0040389. Epub 2012 Jul 5.
4 Interferon-regulated suprabasin is essential for stress-induced stem-like cell conversion and therapy resistance of human malignancies.Mol Oncol. 2019 Jul;13(7):1467-1489. doi: 10.1002/1878-0261.12480. Epub 2019 Jun 10.
5 Suprabasin is hypomethylated and associated with metastasis in salivary adenoid cystic carcinoma.PLoS One. 2012;7(11):e48582. doi: 10.1371/journal.pone.0048582. Epub 2012 Nov 7.
6 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
7 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
8 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
9 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
10 Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
11 Roles of acyl-CoA synthetase long-chain family member 5 and colony stimulating factor 2 in inhibition of palmitic or stearic acids in lung cancer cell proliferation and metabolism. Cell Biol Toxicol. 2021 Feb;37(1):15-34. doi: 10.1007/s10565-020-09520-w. Epub 2020 Apr 28.
12 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.