Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8CV3H5)

DOT Name	NADH dehydrogenase 1 alpha subcomplex subunit 7 (NDUFA7)
Synonyms	Complex I-B14.5a; CI-B14.5a; NADH-ubiquinone oxidoreductase subunit B14.5a
Gene Name	NDUFA7
Related Disease	Rheumatoid arthritis ( )
UniProt ID	NDUA7_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	5XTB; 5XTD; 5XTH; 5XTI
Pfam ID	PF07347
Sequence	MASATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGR RESVPPSIIMSSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL
Function	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
KEGG Pathway	Oxidative phosphorylation (hsa00190 ) Metabolic pathways (hsa01100 ) Thermogenesis (hsa04714 ) Retrograde endocan.binoid sig.ling (hsa04723 ) Non-alcoholic fatty liver disease (hsa04932 ) Alzheimer disease (hsa05010 ) Parkinson disease (hsa05012 ) Amyotrophic lateral sclerosis (hsa05014 ) Huntington disease (hsa05016 ) Prion disease (hsa05020 ) Pathways of neurodegeneration - multiple diseases (hsa05022 ) Chemical carcinogenesis - reactive oxygen species (hsa05208 ) Diabetic cardiomyopathy (hsa05415 )
Reactome Pathway	Complex I biogenesis (R-HSA-6799198 ) Respiratory electron transport (R-HSA-611105 )
BioCyc Pathway	MetaCyc:HS09632-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Rheumatoid arthritis	DISTSB4J	Limited	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Vinblastine	DM5TVS3	Approved	NADH dehydrogenase 1 alpha subcomplex subunit 7 (NDUFA7) affects the response to substance of Vinblastine.	[11]
------------------------------------------------------------------------------------

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of NADH dehydrogenase 1 alpha subcomplex subunit 7 (NDUFA7).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of NADH dehydrogenase 1 alpha subcomplex subunit 7 (NDUFA7).	[3]
Decitabine	DMQL8XJ	Approved	Decitabine decreases the expression of NADH dehydrogenase 1 alpha subcomplex subunit 7 (NDUFA7).	[4]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of NADH dehydrogenase 1 alpha subcomplex subunit 7 (NDUFA7).	[5]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of NADH dehydrogenase 1 alpha subcomplex subunit 7 (NDUFA7).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of NADH dehydrogenase 1 alpha subcomplex subunit 7 (NDUFA7).	[7]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of NADH dehydrogenase 1 alpha subcomplex subunit 7 (NDUFA7).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of NADH dehydrogenase 1 alpha subcomplex subunit 7 (NDUFA7).	[9]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of NADH dehydrogenase 1 alpha subcomplex subunit 7 (NDUFA7).	[10]
------------------------------------------------------------------------------------


⏷ Show the Full List of 9 Drug(s)

References

1	Aggregation of rare/low-frequency variants of the mitochondria respiratory chain-related proteins in rheumatoid arthritis patients.J Hum Genet. 2015 Aug;60(8):449-54. doi: 10.1038/jhg.2015.50. Epub 2015 May 28.
2	Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3	Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
4	The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
5	Growth inhibition of ovarian tumor-initiating cells by niclosamide. Mol Cancer Ther. 2012 Aug;11(8):1703-12.
6	Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
7	Label-free quantitative proteomic analysis identifies the oncogenic role of FOXA1 in BaP-transformed 16HBE cells. Toxicol Appl Pharmacol. 2020 Sep 15;403:115160. doi: 10.1016/j.taap.2020.115160. Epub 2020 Jul 25.
8	Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
9	Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
10	In vitro gene expression data supporting a DNA non-reactive genotoxic mechanism for ochratoxin A. Toxicol Appl Pharmacol. 2007 Apr 15;220(2):216-24.
11	Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.