Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8HISP4)

DOT Name	Cancer/testis antigen 2 (CTAG2)
Synonyms	CT2; Autoimmunogenic cancer/testis antigen NY-ESO-2; Cancer/testis antigen 6.2; CT6.2; L antigen family member 1; LAGE-1
Gene Name	CTAG2
Related Disease	Adenocarcinoma ( ) Advanced cancer ( ) Carcinoma of esophagus ( ) Epithelial ovarian cancer ( ) Esophageal cancer ( ) Esophageal squamous cell carcinoma ( ) Hepatocellular carcinoma ( ) Neoplasm ( ) Neoplasm of esophagus ( ) Ovarian neoplasm ( ) Plasma cell myeloma ( ) Squamous cell carcinoma ( ) Testicular cancer ( ) Colorectal carcinoma ( ) Melanoma ( )
UniProt ID	CTAG2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF09341
Sequence	MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGA PRGPHGGAASAQDGRCPCGARRPDSRLLELHITMPFSSPMEAELVRRILSRDAAPLPRPG AVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRP GTPGPPPPEGAQGDGCRGVAFNVMFSAPHI
Tissue Specificity	Testis and very low level in placenta and in some uterus samples. Observed in 25-50% of tumor samples of melanomas, non-small-cell lung carcinomas, bladder, prostate and head and neck cancers.

Molecular Interaction Atlas (MIA) of This DOT

15 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Carcinoma of esophagus	DISS6G4D	Strong	Altered Expression	[3]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[4]
Esophageal cancer	DISGB2VN	Strong	Altered Expression	[3]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[5]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[6]
Neoplasm	DISZKGEW	Strong	Biomarker	[7]
Neoplasm of esophagus	DISOLKAQ	Strong	Altered Expression	[3]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[4]
Plasma cell myeloma	DIS0DFZ0	Strong	Altered Expression	[2]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[1]
Testicular cancer	DIS6HNYO	moderate	Genetic Variation	[8]
Colorectal carcinoma	DIS5PYL0	Limited	Altered Expression	[9]
Melanoma	DIS1RRCY	Limited	Biomarker	[10]
------------------------------------------------------------------------------------


⏷ Show the Full List of 15 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Cancer/testis antigen 2 (CTAG2).	[11]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Cancer/testis antigen 2 (CTAG2).	[12]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Cancer/testis antigen 2 (CTAG2).	[13]
------------------------------------------------------------------------------------

References

1	[Expression of multiple cancer-testis antigen genes in non-small cell lung cancer treated by chemotherapy prior surgery].Zhonghua Yi Xue Za Zhi. 2004 Mar 17;84(6):464-8.
2	Long-term safety and activity of NY-ESO-1 SPEAR T cells after autologous stem cell transplant for myeloma.Blood Adv. 2019 Jul 9;3(13):2022-2034. doi: 10.1182/bloodadvances.2019000194.
3	Expression of cancer-testis antigens in esophageal cancer and their progress in immunotherapy.J Cancer Res Clin Oncol. 2019 Feb;145(2):281-291. doi: 10.1007/s00432-019-02840-3. Epub 2019 Jan 17.
4	NY-ESO-1 and LAGE-1 cancer-testis antigens are potential targets for immunotherapy in epithelial ovarian cancer.Cancer Res. 2003 Sep 15;63(18):6076-83.
5	Cancer-testis gene expression profiling in esophageal squamous cell carcinoma: identification of specific tumor marker and potential targets for immunotherapy.Cancer Biol Ther. 2011 Aug 1;12(3):191-7. doi: 10.4161/cbt.12.3.15949. Epub 2011 Aug 1.
6	Genomewide investigation of the clinical implications and molecular mechanism of long noncoding RNA LINC00668 and proteincoding genes in hepatocellular carcinoma.Int J Oncol. 2019 Oct;55(4):860-878. doi: 10.3892/ijo.2019.4858. Epub 2019 Aug 14.
7	Sex-Related Differences in Lactotroph Tumor Aggressiveness Are Associated With a Specific Gene-Expression Signature and Genome Instability.Front Endocrinol (Lausanne). 2018 Nov 30;9:706. doi: 10.3389/fendo.2018.00706. eCollection 2018.
8	Pattern of cancer/testis antigen expression in lung cancer patients.Int J Mol Med. 2012 Apr;29(4):656-62. doi: 10.3892/ijmm.2012.896. Epub 2012 Jan 24.
9	Expression profile of cancer-testis genes in 121 human colorectal cancer tissue and adjacent normal tissue.Clin Cancer Res. 2005 Mar 1;11(5):1809-14. doi: 10.1158/1078-0432.CCR-04-1365.
10	Seroreactivity against MAGE-A and LAGE-1 proteins in melanoma patients.Br J Dermatol. 2003 Aug;149(2):282-8. doi: 10.1046/j.1365-2133.2003.05410.x.
11	Treatment of chronic lymphocytic leukemia with a hypomethylating agent induces expression of NXF2, an immunogenic cancer testis antigen. Clin Cancer Res. 2009 May 15;15(10):3406-15. doi: 10.1158/1078-0432.CCR-08-2099. Epub 2009 Apr 28.
12	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
13	DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.