Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9RI580)

• DOT Name: Dysbindin domain-containing protein 2 (DBNDD2)
• Synonyms: Casein kinase-1 binding protein; CK1BP; HSMNP1
• Gene Name: DBNDD2
• UniProt ID: DBND2_HUMAN
• Pfam ID: PF04440
• Sequence:
  MGAGNFLTALEVPVAALAGAASDRRASCERVSPPPPLPHFRLPPLPRSRLPGPVSRPEPG
  APLLGCWLQWGAPSPGPLCLLFRLCSCTCFAPLPAGADMDPNPRAALERQQLRLRERQKF
  FEDILQPETEFVFPLSHLHLESQRPPIGSISSMEVNVDTLEQVELIDLGDPDAADVFLPC
  EDPPPTPQSSGMDNHLEELSLPVPTSDRTTSRTSSSSSSDSSTNLHSPNPSDDGADTPLA
  QSDEEEERGDGGAEPGACS
• Function: May modulate the activity of casein kinase-1. Inhibits CSNK1D autophosphorylation (in vitro).
• Tissue Specificity: Detected in brain.

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Dysbindin domain-containing protein 2 (DBNDD2) affects the response to substance of Fluorouracil.	[12]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Dysbindin domain-containing protein 2 (DBNDD2).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Dysbindin domain-containing protein 2 (DBNDD2).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Dysbindin domain-containing protein 2 (DBNDD2).	[3]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Dysbindin domain-containing protein 2 (DBNDD2).	[4]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Dysbindin domain-containing protein 2 (DBNDD2).	[5]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Dysbindin domain-containing protein 2 (DBNDD2).	[6]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Dysbindin domain-containing protein 2 (DBNDD2).	[7]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Dysbindin domain-containing protein 2 (DBNDD2).	[8]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Dysbindin domain-containing protein 2 (DBNDD2).	[10]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Dysbindin domain-containing protein 2 (DBNDD2).	[11]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Dysbindin domain-containing protein 2 (DBNDD2).	[9]

References

• [1] Evaluation of a human iPSC-derived BBB model for repeated dose toxicity testing with cyclosporine A as model compound. Toxicol In Vitro. 2021 Jun;73:105112. doi: 10.1016/j.tiv.2021.105112. Epub 2021 Feb 22.
• [2] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [3] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [4] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [5] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [6] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [7] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [8] The molecular basis of genistein-induced mitotic arrest and exit of self-renewal in embryonal carcinoma and primary cancer cell lines. BMC Med Genomics. 2008 Oct 10;1:49.
• [9] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [10] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [11] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [12] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.