General Information of Drug Off-Target (DOT) (ID: OTAIV1AK)

DOT Name 5-hydroxytryptamine receptor 3A (HTR3A)
Synonyms 5-HT3-A; 5-HT3A; 5-hydroxytryptamine receptor 3; 5-HT-3; 5-HT3R; Serotonin receptor 3A; Serotonin-gated ion channel receptor
Gene Name HTR3A
UniProt ID
5HT3A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF02931 ; PF02932
Sequence
MLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTT
VSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDI
LINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLH
TIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYAEMKFYVVIRR
RPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDTLPATAI
GTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLERIAWLLCLREQ
STSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQ
ELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA
Function Forms serotonin (5-hydroxytryptamine/5-HT3)-activated cation-selective channel complexes, which when activated cause fast, depolarizing responses in neurons.
Tissue Specificity Expressed in cerebral cortex, amygdala, hippocampus, and testis. Detected in monocytes of the spleen and tonsil, in small and large intestine, uterus, prostate, ovary and placenta.
KEGG Pathway
Serotonergic sy.pse (hsa04726 )
Taste transduction (hsa04742 )
Reactome Pathway
Neurotransmitter receptors and postsynaptic signal transmission (R-HSA-112314 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Clozapine DMFC71L Approved 5-hydroxytryptamine receptor 3A (HTR3A) affects the response to substance of Clozapine. [13]
Gabapentin DM6T924 Approved 5-hydroxytryptamine receptor 3A (HTR3A) increases the Sleep disturbances (incl subtypes) ADR of Gabapentin. [14]
------------------------------------------------------------------------------------
17 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of 5-hydroxytryptamine receptor 3A (HTR3A). [1]
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of 5-hydroxytryptamine receptor 3A (HTR3A). [2]
Decitabine DMQL8XJ Approved Decitabine affects the expression of 5-hydroxytryptamine receptor 3A (HTR3A). [2]
Dexamethasone DMMWZET Approved Dexamethasone decreases the activity of 5-hydroxytryptamine receptor 3A (HTR3A). [3]
Rosiglitazone DMILWZR Approved Rosiglitazone increases the expression of 5-hydroxytryptamine receptor 3A (HTR3A). [4]
Amphotericin B DMTAJQE Approved Amphotericin B increases the expression of 5-hydroxytryptamine receptor 3A (HTR3A). [5]
Capsaicin DMGMF6V Approved Capsaicin decreases the activity of 5-hydroxytryptamine receptor 3A (HTR3A). [6]
Methylprednisolone DM4BDON Approved Methylprednisolone decreases the activity of 5-hydroxytryptamine receptor 3A (HTR3A). [3]
Metoclopramide DMFA5MY Approved Metoclopramide decreases the activity of 5-hydroxytryptamine receptor 3A (HTR3A). [7]
Sufentanil DMU7YEL Approved Sufentanil affects the activity of 5-hydroxytryptamine receptor 3A (HTR3A). [8]
Hydromorphone DMHP21E Approved Hydromorphone affects the activity of 5-hydroxytryptamine receptor 3A (HTR3A). [8]
Alfentanil DMVO0UB Approved Alfentanil affects the activity of 5-hydroxytryptamine receptor 3A (HTR3A). [8]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of 5-hydroxytryptamine receptor 3A (HTR3A). [9]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the expression of 5-hydroxytryptamine receptor 3A (HTR3A). [11]
geraniol DMS3CBD Investigative geraniol decreases the activity of 5-hydroxytryptamine receptor 3A (HTR3A). [6]
gingerol DMNXYSM Investigative gingerol decreases the activity of 5-hydroxytryptamine receptor 3A (HTR3A). [6]
carvacrol DMINM2D Investigative carvacrol increases the activity of 5-hydroxytryptamine receptor 3A (HTR3A). [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 17 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of 5-hydroxytryptamine receptor 3A (HTR3A). [10]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of 5-hydroxytryptamine receptor 3A (HTR3A). [12]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
[3H]GR65630 DMMHSYA Investigative [3H]GR65630 affects the binding of 5-hydroxytryptamine receptor 3A (HTR3A). [7]
------------------------------------------------------------------------------------

References

1 Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
2 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
3 Inhibitory effect of glucocorticoids on human-cloned 5-hydroxytryptamine3A receptor expressed in xenopus oocytes. Anesthesiology. 2004 Sep;101(3):660-5. doi: 10.1097/00000542-200409000-00014.
4 Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
5 Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
6 Activation and modulation of recombinantly expressed serotonin receptor type 3A by terpenes and pungent substances. Biochem Biophys Res Commun. 2015 Nov 27;467(4):1090-6. doi: 10.1016/j.bbrc.2015.09.074. Epub 2015 Oct 9.
7 Interactions of metoclopramide and ergotamine with human 5-HT(3A) receptors and human 5-HT reuptake carriers. Br J Pharmacol. 2005 Oct;146(4):543-52. doi: 10.1038/sj.bjp.0706351.
8 The effects of fentanyl-like opioids and hydromorphone on human 5-HT3A receptors. Anesth Analg. 2008 Jul;107(1):107-12. doi: 10.1213/ane.0b013e31817342c2.
9 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
11 Assessment of caffeine neurotoxicity using novel biomarkers of neural function in SH-SY5Y cells - Is there a need for environmental concern?. Chem Biol Interact. 2022 Sep 25;365:110082. doi: 10.1016/j.cbi.2022.110082. Epub 2022 Aug 5.
12 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
13 Influence of serotonin 3A and 3B receptor genes on clozapine treatment response in schizophrenia. Pharmacogenet Genomics. 2010 Apr;20(4):274-6. doi: 10.1097/FPC.0b013e328337ce3e.
14 ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.