Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTANIFBG)

• DOT Name: RNA-binding protein 43 (RBM43)
• Synonyms: RNA-binding motif protein 43
• Gene Name: RBM43
• Related Disease:
  Esophageal adenocarcinoma
  Gastroesophageal reflux disease
• UniProt ID: RBM43_HUMAN
• Sequence:
  MASVLNVKESKAPERTVVVAGLPVDLFSDQLLAVLVKSHFQDIKNEGGDVEDVIYPTRTK
  GVAYVIFKEKKVAENVIRQKKHWLARKTRHAELTVSLRVSHFGDKIFSSVNAILDLSVFG
  KEVTLETLVKDLKKKIPSLSFSPLKPNGRISVEGSFLAVKRLRESLLARACSLLEKDRNF
  TSEERKWNRQNPQRNLQRSNNSLASVRTLVPETARSGEMLVLDTDVFLYLKHKCGSYEST
  LKKFHILSQEKVDGEITTICLKSIQVGSQPNNAKHVKELIEEWSHALYLKLRKETFILEG
  KENREKRMIKRACEQLSSRYLEVLINLYRTHIDIIGSSSDTYLFKKGVMKLIGQKVS

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Esophageal adenocarcinoma	DISODWFP	Strong	Genetic Variation	[1]
Gastroesophageal reflux disease	DISQ8G5S	Strong	Genetic Variation	[1]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of RNA-binding protein 43 (RBM43).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of RNA-binding protein 43 (RBM43).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of RNA-binding protein 43 (RBM43).	[4]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of RNA-binding protein 43 (RBM43).	[5]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of RNA-binding protein 43 (RBM43).	[5]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of RNA-binding protein 43 (RBM43).	[6]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of RNA-binding protein 43 (RBM43).	[9]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of RNA-binding protein 43 (RBM43).	[10]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of RNA-binding protein 43 (RBM43).	[7]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of RNA-binding protein 43 (RBM43).	[8]

References

• [1] Interactions Between Genetic Variants and Environmental Factors Affect Risk of Esophageal Adenocarcinoma and Barrett's Esophagus.Clin Gastroenterol Hepatol. 2018 Oct;16(10):1598-1606.e4. doi: 10.1016/j.cgh.2018.03.007. Epub 2018 Mar 15.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [6] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [9] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [10] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.