Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTATKUA8)

• DOT Name: Dysbindin domain-containing protein 1 (DBNDD1)
• Gene Name: DBNDD1
• Related Disease: Melanoma
• UniProt ID: DBND1_HUMAN
• Pfam ID: PF04440
• Sequence:
  MEPPEGAGTGEIVKEAEVPQAALGVPAQGTGDNGHTPVEEEVGGIPVPAPGLLQVTERRQ
  PLSSVSSLEVHFDLLDLTELTDMSDQELAEVFADSDDENLNTESPAGLHPLPRAGYLRSP
  SWTRTRAEQSHEKQPLGDPERQATVLDTFLTVERPQED

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Melanoma	DIS1RRCY	Definitive	Genetic Variation	[1]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Dysbindin domain-containing protein 1 (DBNDD1).	[2]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Dysbindin domain-containing protein 1 (DBNDD1).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Dysbindin domain-containing protein 1 (DBNDD1).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Dysbindin domain-containing protein 1 (DBNDD1).	[5]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Dysbindin domain-containing protein 1 (DBNDD1).	[6]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Dysbindin domain-containing protein 1 (DBNDD1).	[7]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Dysbindin domain-containing protein 1 (DBNDD1).	[8]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Dysbindin domain-containing protein 1 (DBNDD1).	[9]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Dysbindin domain-containing protein 1 (DBNDD1).	[10]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Dysbindin domain-containing protein 1 (DBNDD1).	[11]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Dysbindin domain-containing protein 1 (DBNDD1).	[12]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Dysbindin domain-containing protein 1 (DBNDD1).	[13]

References

• [1] A unique genome-wide association analysis in extended Utah high-risk pedigrees identifies a novel melanoma risk variant on chromosome arm 10q.Hum Genet. 2012 Jan;131(1):77-85. doi: 10.1007/s00439-011-1048-z. Epub 2011 Jun 26.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [4] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [5] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [6] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [7] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [8] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [9] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [10] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [11] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [12] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [13] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.