Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAYTUQM)

• DOT Name: Hippocampus abundant transcript-like protein 1 (MFSD14B)
• Synonyms: Major facilitator superfamily domain-containing 14B
• Gene Name: MFSD14B
• Related Disease: Colorectal carcinoma
• UniProt ID: MF14B_HUMAN
• Pfam ID: PF07690
• Sequence:
  MSVEPPPELEEKAASEPEAGAMPEKRAGAQAAGSTWLQGFGRPSVYHAAIVIFLEFFAWG
  LLTTPMLTVLHETFSQHTFLMNGLIQGVKGLLSFLSAPLIGALSDVWGRKPFLLGTVFFT
  CFPIPLMRISPWWYFAMISVSGVFSVTFSVIFAYVADVTQEHERSTAYGWVSATFAASLV
  SSPAIGAYLSASYGDSLVVLVATVVALLDICFILVAVPESLPEKMRPVSWGAQISWKQAD
  PFASLKKVGKDSTVLLICITVFLSYLPEAGQYSSFFLYLRQVIGFGSVKIAAFIAMVGIL
  SIVAQTAFLSILMRSLGNKNTVLLGLGFQMLQLAWYGFGSQAWMMWAAGTVAAMSSITFP
  AISALVSRNAESDQQGVAQGIITGIRGLCNGLGPALYGFIFYMFHVELTELGPKLNSNNV
  PLQGAVIPGPPFLFGACIVLMSFLVALFIPEYSKASGVQKHSNSSSGSLTNTPERGSDED
  IEPLLQDSSIWELSSFEEPGNQCTEL

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[1]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Hippocampus abundant transcript-like protein 1 (MFSD14B).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Hippocampus abundant transcript-like protein 1 (MFSD14B).	[3]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Hippocampus abundant transcript-like protein 1 (MFSD14B).	[5]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Hippocampus abundant transcript-like protein 1 (MFSD14B).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Hippocampus abundant transcript-like protein 1 (MFSD14B).	[4]

References

• [1] Genome-Wide Interaction Analyses between Genetic Variants and Alcohol Consumption and Smoking for Risk of Colorectal Cancer.PLoS Genet. 2016 Oct 10;12(10):e1006296. doi: 10.1371/journal.pgen.1006296. eCollection 2016 Oct.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [5] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [6] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.