Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBSOW3J)

• DOT Name: SS18-like protein 2 (SS18L2)
• Synonyms: SYT homolog 2
• Gene Name: SS18L2
• Related Disease: Synovial sarcoma
• UniProt ID: S18L2_HUMAN
• Pfam ID: PF05030
• Sequence:
  MSVAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLHRNLIY
  LATIADASPTSTSKAME

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Synovial sarcoma	DISEZJS7	Strong	Biomarker	[1]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of SS18-like protein 2 (SS18L2).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of SS18-like protein 2 (SS18L2).	[3]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of SS18-like protein 2 (SS18L2).	[4]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of SS18-like protein 2 (SS18L2).	[5]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of SS18-like protein 2 (SS18L2).	[6]
Selenium	DM25CGV	Approved	Selenium decreases the expression of SS18-like protein 2 (SS18L2).	[7]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of SS18-like protein 2 (SS18L2).	[8]
Phenol	DM1QSM3	Phase 2/3	Phenol decreases the expression of SS18-like protein 2 (SS18L2).	[9]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of SS18-like protein 2 (SS18L2).	[11]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of SS18-like protein 2 (SS18L2).	[12]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of SS18-like protein 2 (SS18L2).	[13]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of SS18-like protein 2 (SS18L2).	[14]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of SS18-like protein 2 (SS18L2).	[10]

References

• [1] Common origin of the human synovial sarcoma associated SS18 and SS18L1 gene loci.Cytogenet Genome Res. 2006;112(3-4):222-6. doi: 10.1159/000089874.
• [2] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [3] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [4] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [5] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [6] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [7] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [8] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [9] Classification of heavy-metal toxicity by human DNA microarray analysis. Environ Sci Technol. 2007 May 15;41(10):3769-74.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [12] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [13] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [14] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.