Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC08RWQ)

• DOT Name: Mpv17-like protein 2 (MPV17L2)
• Gene Name: MPV17L2
• Related Disease: Multiple sclerosis
• UniProt ID: M17L2_HUMAN
• Pfam ID: PF04117
• Sequence:
  MARGGWRRLRRLLSAGQLLFQGRALLVTNTLGCGALMAAGDGVRQSWEIRARPGQVFDPR
  RSASMFAVGCSMGPFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWYFLG
  LGCLEGQTVGESCQELREKFWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDT
  YLSYLKYRSPVPLTPPGCVALDTRAD
• Function: Required for the assembly and stability of the mitochondrial ribosome. Is a positive regulator of mitochondrial protein synthesis.
• KEGG Pathway: Peroxisome (hsa04146)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Multiple sclerosis	DISB2WZI	Strong	Genetic Variation	[1]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Mpv17-like protein 2 (MPV17L2).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Mpv17-like protein 2 (MPV17L2).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Mpv17-like protein 2 (MPV17L2).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Mpv17-like protein 2 (MPV17L2).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Mpv17-like protein 2 (MPV17L2).	[6]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Mpv17-like protein 2 (MPV17L2).	[7]

References

• [1] Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.Nature. 2011 Aug 10;476(7359):214-9. doi: 10.1038/nature10251.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [7] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.