Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC12ETA)

• DOT Name: Uncharacterized protein FAM241A (FAM241A)
• Gene Name: FAM241A
• UniProt ID: F241A_HUMAN
• Pfam ID: PF15378
• Sequence:
  MCSAGELLRGGDGGERDEDGDALAEREAAGTGWDPGASPRRRGQRPKESEQDVEDSQNHT
  GEPVGDDYKKMGTLFGELNKNLINMGFTRMYFGERIVEPVIVIFFWVMLWFLGLQALGLV
  AVLCLVIIYVQQ

Molecular Interaction Atlas (MIA) of This DOT

24 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Uncharacterized protein FAM241A (FAM241A).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Uncharacterized protein FAM241A (FAM241A).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Uncharacterized protein FAM241A (FAM241A).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Uncharacterized protein FAM241A (FAM241A).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Uncharacterized protein FAM241A (FAM241A).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Uncharacterized protein FAM241A (FAM241A).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Uncharacterized protein FAM241A (FAM241A).	[7]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Uncharacterized protein FAM241A (FAM241A).	[9]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Uncharacterized protein FAM241A (FAM241A).	[10]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Uncharacterized protein FAM241A (FAM241A).	[11]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of Uncharacterized protein FAM241A (FAM241A).	[12]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol affects the expression of Uncharacterized protein FAM241A (FAM241A).	[13]
Fenofibrate	DMFKXDY	Approved	Fenofibrate increases the expression of Uncharacterized protein FAM241A (FAM241A).	[14]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Uncharacterized protein FAM241A (FAM241A).	[15]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Uncharacterized protein FAM241A (FAM241A).	[16]
Genistein	DM0JETC	Phase 2/3	Genistein affects the expression of Uncharacterized protein FAM241A (FAM241A).	[13]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Uncharacterized protein FAM241A (FAM241A).	[17]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Uncharacterized protein FAM241A (FAM241A).	[18]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Uncharacterized protein FAM241A (FAM241A).	[19]
PMID27336223-Compound-5	DM6E50A	Patented	PMID27336223-Compound-5 decreases the expression of Uncharacterized protein FAM241A (FAM241A).	[12]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Uncharacterized protein FAM241A (FAM241A).	[20]
KOJIC ACID	DMP84CS	Investigative	KOJIC ACID increases the expression of Uncharacterized protein FAM241A (FAM241A).	[21]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE decreases the expression of Uncharacterized protein FAM241A (FAM241A).	[22]
Resorcinol	DMM37C0	Investigative	Resorcinol increases the expression of Uncharacterized protein FAM241A (FAM241A).	[23]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Uncharacterized protein FAM241A (FAM241A).	[8]

References

• [1] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [8] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [9] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [10] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [11] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [12] PPARgamma controls CD1d expression by turning on retinoic acid synthesis in developing human dendritic cells. J Exp Med. 2006 Oct 2;203(10):2351-62.
• [13] Dose- and time-dependent transcriptional response of Ishikawa cells exposed to genistein. Toxicol Sci. 2016 May;151(1):71-87.
• [14] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [15] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [16] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [17] Inter- and intra-laboratory study to determine the reproducibility of toxicogenomics datasets. Toxicology. 2011 Nov 28;290(1):50-8.
• [18] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [19] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [20] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [21] Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.
• [22] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [23] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.