Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDPEHC4)

DOT Name LIM/homeobox protein Lhx9 (LHX9)
Synonyms LIM homeobox protein 9
Gene Name LHX9
Related Disease
Astrocytoma ( )
Glioma ( )
Malignant glioma ( )
Gonadal dysgenesis ( )
Turner syndrome ( )
UniProt ID
LHX9_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2DMQ
Pfam ID
PF00046 ; PF00412
Sequence
MEIVGCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGM
PPLSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYC
KEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSL
VYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGVDIV
NYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQL
AQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTAT
TLTDLTNPTITVVTSVTSNMDSHESGSPSQTTLTNLF
Function Involved in gonadal development.
Reactome Pathway
Regulation of expression of SLITs and ROBOs (R-HSA-9010553 )

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Astrocytoma DISL3V18 Definitive Posttranslational Modification [1]
Glioma DIS5RPEH Definitive Altered Expression [1]
Malignant glioma DISFXKOV Definitive Altered Expression [1]
Gonadal dysgenesis DISIL2ZI Strong Genetic Variation [2]
Turner syndrome DIS2035C Strong Genetic Variation [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of LIM/homeobox protein Lhx9 (LHX9). [3]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of LIM/homeobox protein Lhx9 (LHX9). [4]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of LIM/homeobox protein Lhx9 (LHX9). [3]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of LIM/homeobox protein Lhx9 (LHX9). [5]
------------------------------------------------------------------------------------

References

1 Aberrant methylation and reduced expression of LHX9 in malignant gliomas of childhood.Neoplasia. 2009 Jul;11(7):700-11. doi: 10.1593/neo.09406.
2 Absence of mutations involving the LIM homeobox domain gene LHX9 in 46,XY gonadal agenesis and dysgenesis.J Clin Endocrinol Metab. 2001 Jun;86(6):2465-9. doi: 10.1210/jcem.86.6.7539.
3 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
4 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
5 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.