Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDTL9UE)

• DOT Name: Putative methyltransferase NSUN7 (NSUN7)
• Synonyms: EC 2.1.1.-; NOL1/NOP2/Sun domain family member 7
• Gene Name: NSUN7
• Related Disease: Male infertility
• UniProt ID: NSUN7_HUMAN
• EC Number: 2.1.1.-
• Pfam ID: PF01189 ; PF21148
• Sequence:
  MLNSTGELEFSNEEDPEIISQLTSLPLSGGKSSAGVPEKTGYPDSVYVMAANIFQGIRIE
  KSAQKVLIKYGNEPLRSLSESEDQSFQRLSYELAFSALKYQDILETILIDSCIFPSTTIP
  DHLSSLIIVMLYDFQDRKFQTRVLSDNEEPISEVQEVENLLNSFKIKLAAALARCRIKHD
  ALSIYHILPETVRKQELRASTLPLYAWINTCKISPEEVYNNLKRRGYNKVKSVLHIDDKV
  FAVDQHCYDVLIFPSHLKNDLINIDLFKDYKLIFQDKSRSLAVHSVKALLNMDDDVLMVN
  TGSWYTVSHMSILTNNNTSKVFVCGVQSQAKDPDLKTLFTKIGCKNIEILHEKFINIESK
  DHRLQKVKVILLLPRCSGLGVSNPVEFILNEHEDTEFLKDHSQGGISVDKLHVLAQQQYE
  QLTHAMKFTKAQAVVYCTCSVFPEENEAVVKKALEFQDLGNKGQPYRLSPPVLPLCSLKE
  IQLSTDKFFRMEPSEITNGCFLSILTRERDPSETVSVNDVLARAAAKGLLDGIELGKSSK
  REKKKKKSKTSLTKGATTDNGIQMKIAEFLNRETKASANLSETVTKPPLPQKNTAQVGAS
  SQTRKPNKLAPHPAVPAFVKNTCPSRPRERQTHFLRPRPEDRMVALKPIKIVLPPVFMPF
  SSPQGIRSRMPTQHLYCRWVAPKALVPTCLPTHSLSRKEEKPKDDTPSSLLRPPRRWL
• Function: May have S-adenosyl-L-methionine-dependent methyl-transferase activity.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Male infertility	DISY3YZZ	Strong	Genetic Variation	[1]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Putative methyltransferase NSUN7 (NSUN7).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Putative methyltransferase NSUN7 (NSUN7).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Putative methyltransferase NSUN7 (NSUN7).	[4]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Putative methyltransferase NSUN7 (NSUN7).	[5]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Putative methyltransferase NSUN7 (NSUN7).	[4]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Putative methyltransferase NSUN7 (NSUN7).	[6]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Putative methyltransferase NSUN7 (NSUN7).	[6]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Putative methyltransferase NSUN7 (NSUN7).	[8]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Putative methyltransferase NSUN7 (NSUN7).	[7]

References

• [1] The Nsun7 (A11337)-deletion mutation, causes reduction of its protein rate and associated with sperm motility defect in infertile men.J Assist Reprod Genet. 2015 May;32(5):807-15. doi: 10.1007/s10815-015-0443-0. Epub 2015 Feb 22.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [4] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [5] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [6] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.