Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEAAVK7)

• DOT Name: Transmembrane protein 267 (TMEM267)
• Gene Name: TMEM267
• UniProt ID: TM267_HUMAN
• Sequence:
  MASETEKTHALLQTCSTESLISSLGLGAFCLVADRLLQFSTIQQNDWLRALSDNAVHCVI
  GMWSWAVVTGIKKKTDFGEIILAGFLASVIDVDHFFLAGSMSLKAALTLPRRPFLHCSTV
  IPVVVLTLKFTMHLFKLKDSWCFLPWMLFISWTSHHIRDGIRHGLWICPFGKTSPLPFWL
  YVIITSSLPHICSFVMYLTGTRQMMSSKHGVRIDV

Molecular Interaction Atlas (MIA) of This DOT

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Transmembrane protein 267 (TMEM267).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Transmembrane protein 267 (TMEM267).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Transmembrane protein 267 (TMEM267).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Transmembrane protein 267 (TMEM267).	[4]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Transmembrane protein 267 (TMEM267).	[5]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Transmembrane protein 267 (TMEM267).	[6]
Irinotecan	DMP6SC2	Approved	Irinotecan decreases the expression of Transmembrane protein 267 (TMEM267).	[7]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide decreases the expression of Transmembrane protein 267 (TMEM267).	[5]
Lindane	DMB8CNL	Approved	Lindane increases the expression of Transmembrane protein 267 (TMEM267).	[5]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Transmembrane protein 267 (TMEM267).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Transmembrane protein 267 (TMEM267).	[5]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Transmembrane protein 267 (TMEM267).	[9]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Transmembrane protein 267 (TMEM267).	[10]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Transcriptome-based functional classifiers for direct immunotoxicity. Arch Toxicol. 2014 Mar;88(3):673-89.
• [6] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [7] Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
• [8] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [9] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [10] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.