Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEHZ21P)

• DOT Name: Cerebral cavernous malformations 2 protein-like (CCM2L)
• Synonyms: CCM2-like
• Gene Name: CCM2L
• UniProt ID: CCM2L_HUMAN
• Pfam ID: PF16545
• Sequence:
  MEYEVKKGKKGFVSPIRRLVFPKAGRRAACRSSVSRRPLHSMPLYPPDYLIDPQILLCDY
  LEKEVKFLGHLTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLL
  TWRDNEELILRIPTHEIAAASYLQDDALHLLVLKTGLGVDPVPAGVDASPGGAGRDPGPP
  GGAPEKRRVGTAERRHTICSLDWRMGWGGGAAEARAGGGGGGSLERQRAGARASGSWERR
  QTFSGSWERRHGGGGGGGGAGKPGGSWERRQAGSGGGGSWERRHPGPNPLDPQDPSPDAY
  CNLVILAVANRDAAEESCALICQVFQIIYGDQSIECVDRAGYHYTSTPERPWLCSRSESC
  HTDGTYAYDADFSCCSSFNGSQDTFEACYSGTSTPSFHGSHCSGSDHSSLGLEQLQDYMV
  TLRSKLGPLEIQQFAMLLREYRLGLPIQDYCTGLLKLYGDRRKFLLLGMRPFIPDQDIGY
  FEGFLEGVGIREGGILTDSFGRIKRSMSSTSASAVRSYDGAAQRPEAQAFHRLLADITHD
  IEALAPDDDDDDEDEPRGSRGGSDAAEDNYL

Molecular Interaction Atlas (MIA) of This DOT

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Cerebral cavernous malformations 2 protein-like (CCM2L).	[1]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Cerebral cavernous malformations 2 protein-like (CCM2L).	[2]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Cerebral cavernous malformations 2 protein-like (CCM2L).	[3]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Cerebral cavernous malformations 2 protein-like (CCM2L).	[4]
Malathion	DMXZ84M	Approved	Malathion increases the expression of Cerebral cavernous malformations 2 protein-like (CCM2L).	[5]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Cerebral cavernous malformations 2 protein-like (CCM2L).	[3]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Cerebral cavernous malformations 2 protein-like (CCM2L).	[7]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Cerebral cavernous malformations 2 protein-like (CCM2L).	[3]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Cerebral cavernous malformations 2 protein-like (CCM2L).	[8]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Cerebral cavernous malformations 2 protein-like (CCM2L).	[6]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Epidermal growth factor receptor signalling in human breast cancer cells operates parallel to estrogen receptor alpha signalling and results in tamoxifen insensitive proliferation. BMC Cancer. 2014 Apr 23;14:283.
• [3] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [4] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [5] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [8] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.