Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTESX51F)

• DOT Name: Bombesin receptor-activated protein C6orf89 (C6ORF89)
• Synonyms: Amfion
• Gene Name: C6ORF89
• UniProt ID: CF089_HUMAN
• Sequence:
  MDLAANEISIYDKLSETVDLVRQTGHQCGMSEKAIEKFIRQLLEKNEPQRPPPQYPLLIV
  VYKVLATLGLILLTAYFVIQPFSPLAPEPVLSGAHTWRSLIHHIRLMSLPIAKKYMSENK
  GVPLHGGDEDRPFPDFDPWWTNDCEQNESEPIPANCTGCAQKHLKVMLLEDAPRKFERLH
  PLVIKTGKPLLEEEIQHFLCQYPEATEGFSEGFFAKWWRCFPERWFPFPYPWRRPLNRSQ
  MLRELFPVFTHLPFPKDASLNKCSFLHPEPVVGSKMHKMPDLFIIGSGEAMLQLIPPFQC
  RRHCQSVAMPIEPGDIGYVDTTHWKVYVIARGVQPLVICDGTAFSEL
• Function: Exhibits histone deacetylase (HDAC) enhancer properties. May play a role in cell cycle progression and wound repair of bronchial epithelial cells.

Molecular Interaction Atlas (MIA) of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Bombesin receptor-activated protein C6orf89 (C6ORF89).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Bombesin receptor-activated protein C6orf89 (C6ORF89).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Bombesin receptor-activated protein C6orf89 (C6ORF89).	[3]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Bombesin receptor-activated protein C6orf89 (C6ORF89).	[4]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Bombesin receptor-activated protein C6orf89 (C6ORF89).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Bombesin receptor-activated protein C6orf89 (C6ORF89).	[6]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Bombesin receptor-activated protein C6orf89 (C6ORF89).	[7]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [5] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [6] New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
• [7] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.