General Information of Drug Off-Target (DOT) (ID: OTF4IL5J)

DOT Name Homeobox protein Nkx-2.3 (NKX2-3)
Synonyms Homeobox protein NK-2 homolog C
Gene Name NKX2-3
Related Disease
Coeliac disease ( )
Irritable bowel syndrome ( )
T-cell acute lymphoblastic leukaemia ( )
Ulcerative colitis ( )
Inflammatory bowel disease ( )
leukaemia ( )
Leukemia ( )
Neuroendocrine cancer ( )
Advanced cancer ( )
Colorectal carcinoma ( )
Lymphoma ( )
Neoplasm ( )
UniProt ID
NKX23_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00046
Sequence
MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSDGGE
EDEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQK
SCQLKKSLETAGDCKAAEESERPKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREH
LASSLKLTSTQVKIWFQNRRYKCKRQRQDKSLELGAHAPPPPPRRVAVPVLVRDGKPCVT
PSAQAYGAPYSVGASAYSYNSFPAYGYGNSAAAAAAAAAAAAAAAAYSSSYGCAYPAGGG
GGGGGTSAATTAMQPACSAAGGGPFVNVSNLGGFGSGGSAQPLHQGTAAGAACAQGTLQG
IRAW
Function Transcription factor.

Molecular Interaction Atlas (MIA) of This DOT

12 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Coeliac disease DISIY60C Strong Genetic Variation [1]
Irritable bowel syndrome DIS27206 Strong Genetic Variation [2]
T-cell acute lymphoblastic leukaemia DIS17AI2 Strong Genetic Variation [3]
Ulcerative colitis DIS8K27O Strong Genetic Variation [4]
Inflammatory bowel disease DISGN23E moderate Altered Expression [5]
leukaemia DISS7D1V moderate Biomarker [6]
Leukemia DISNAKFL moderate Biomarker [6]
Neuroendocrine cancer DISVGJET moderate Altered Expression [7]
Advanced cancer DISAT1Z9 Limited Altered Expression [8]
Colorectal carcinoma DIS5PYL0 Limited Biomarker [9]
Lymphoma DISN6V4S Limited Altered Expression [8]
Neoplasm DISZKGEW Limited Altered Expression [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of Homeobox protein Nkx-2.3 (NKX2-3). [10]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Homeobox protein Nkx-2.3 (NKX2-3). [11]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Homeobox protein Nkx-2.3 (NKX2-3). [12]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Homeobox protein Nkx-2.3 (NKX2-3). [13]
------------------------------------------------------------------------------------

References

1 Lack of association of NKX2-3, IRGM, and ATG16L1 inflammatory bowel disease susceptibility variants with celiac disease.Hum Immunol. 2009 Nov;70(11):946-9. doi: 10.1016/j.humimm.2009.08.004. Epub 2009 Aug 13.
2 NKX2-3 variant rs11190140 is associated with IBD and alters binding of NFAT.Mol Genet Metab. 2011 Sep-Oct;104(1-2):174-9. doi: 10.1016/j.ymgme.2011.06.023. Epub 2011 Jul 6.
3 TCR rearrangements identify a subgroup of NKL-deregulated adult T-ALLs associated with favorable outcome.Leukemia. 2018 Jan;32(1):61-71. doi: 10.1038/leu.2017.176. Epub 2017 Jun 8.
4 Characteristics of Japanese inflammatory bowel disease susceptibility loci.J Gastroenterol. 2014 Aug;49(8):1217-30. doi: 10.1007/s00535-013-0866-2. Epub 2013 Aug 13.
5 Differential Effects of the Absence of Nkx2-3 and MAdCAM-1 on the Distribution of Intestinal Type 3 Innate Lymphoid Cells and Postnatal SILT Formation in Mice.Front Immunol. 2019 Mar 5;10:366. doi: 10.3389/fimmu.2019.00366. eCollection 2019.
6 Unique long non-coding RNA expression signature in ETV6/RUNX1-driven B-cell precursor acute lymphoblastic leukemia.Oncotarget. 2016 Nov 8;7(45):73769-73780. doi: 10.18632/oncotarget.12063.
7 Novel markers for enterochromaffin cells and gastrointestinal neuroendocrine carcinomas.Mod Pathol. 2009 Feb;22(2):261-72. doi: 10.1038/modpathol.2008.174. Epub 2008 Oct 24.
8 Homeobox NKX2-3 promotes marginal-zone lymphomagenesis by activating B-cell receptor signalling and shaping lymphocyte dynamics.Nat Commun. 2016 Jun 14;7:11889. doi: 10.1038/ncomms11889.
9 Genes regulated by Nkx2-3 in sporadic and inflammatory bowel disease-associated colorectal cancer cell lines.Dig Dis Sci. 2010 Nov;55(11):3171-80. doi: 10.1007/s10620-010-1138-0. Epub 2010 Feb 18.
10 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
11 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
12 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
13 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.