Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFDI7JP)

• DOT Name: Small integral membrane protein 19 (SMIM19)
• Gene Name: SMIM19
• UniProt ID: SMI19_HUMAN
• Pfam ID: PF15117
• Sequence:
  MAGGYGVMGDDGSIDYTVHEAWNEATNVYLIVILVSFGLFMYAKRNKRRIMRIFSVPPTE
  ETLSEPNFYDTISKIRLRQQLEMYSISRKYDYQQPQNQADSVQLSLE

Molecular Interaction Atlas (MIA) of This DOT

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Small integral membrane protein 19 (SMIM19).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Small integral membrane protein 19 (SMIM19).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Small integral membrane protein 19 (SMIM19).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Small integral membrane protein 19 (SMIM19).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Small integral membrane protein 19 (SMIM19).	[5]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Small integral membrane protein 19 (SMIM19).	[6]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Small integral membrane protein 19 (SMIM19).	[7]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Small integral membrane protein 19 (SMIM19).	[8]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Small integral membrane protein 19 (SMIM19).	[8]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Small integral membrane protein 19 (SMIM19).	[10]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Small integral membrane protein 19 (SMIM19).	[11]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Small integral membrane protein 19 (SMIM19).	[12]
Resorcinol	DMM37C0	Investigative	Resorcinol decreases the expression of Small integral membrane protein 19 (SMIM19).	[13]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Small integral membrane protein 19 (SMIM19).	[9]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [7] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [8] Time series analysis of oxidative stress response patterns in HepG2: a toxicogenomics approach. Toxicology. 2013 Apr 5;306:24-34.
• [9] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [10] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [11] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [12] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [13] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.