Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGDJJOK)

DOT Name Complement component C8 beta chain (C8B)
Synonyms Complement component 8 subunit beta
Gene Name C8B
Related Disease
Complement component 6 deficiency ( )
Complement deficiency ( )
Juvenile idiopathic arthritis ( )
Meningitis ( )
Type II complement component 8 deficiency ( )
Immunodeficiency ( )
Myocardial infarction ( )
UniProt ID
CO8B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3OJY; 6H03; 6H04; 7NYC; 7NYD; 8B0F; 8B0G; 8B0H
Pfam ID
PF21195 ; PF00057 ; PF01823 ; PF00090
Sequence
MKNSRTWAWRAPVELFLLCAALGCLSLPGSRGERPHSFGSNAVNKSFAKSRQMRSVDVTL
MPIDCELSSWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCGSQV
RCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGIN
LFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFILKEYESYSDF
ERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLHARSDLE
VAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVM
NKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMV
EDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFA
YSSTVRQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRK
NTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS
Function Constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells.
KEGG Pathway
Complement and coagulation cascades (hsa04610 )
Regulation of actin cytoskeleton (hsa04810 )
Prion disease (hsa05020 )
Amoebiasis (hsa05146 )
Coro.virus disease - COVID-19 (hsa05171 )
Systemic lupus erythematosus (hsa05322 )
Reactome Pathway
Regulation of Complement cascade (R-HSA-977606 )
Terminal pathway of complement (R-HSA-166665 )

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Complement component 6 deficiency DISY31NP Strong CausalMutation [1]
Complement deficiency DISGN469 Strong Biomarker [1]
Juvenile idiopathic arthritis DISQZGBV Strong Biomarker [2]
Meningitis DISQABAA Strong Biomarker [3]
Type II complement component 8 deficiency DIS9RHTB Strong Autosomal recessive [1]
Immunodeficiency DIS093I0 Limited Biomarker [3]
Myocardial infarction DIS655KI Limited Biomarker [4]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Complement component C8 beta chain (C8B). [5]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Complement component C8 beta chain (C8B). [6]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Complement component C8 beta chain (C8B). [7]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Complement component C8 beta chain (C8B). [8]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Complement component C8 beta chain (C8B). [9]
Troglitazone DM3VFPD Approved Troglitazone decreases the expression of Complement component C8 beta chain (C8B). [10]
Rosiglitazone DMILWZR Approved Rosiglitazone decreases the expression of Complement component C8 beta chain (C8B). [10]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Complement component C8 beta chain (C8B). [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 A novel mutation in a patient with a deficiency of the eighth component of complement associated with recurrent meningococcal meningitis. J Clin Immunol. 2009 Sep;29(5):691-5. doi: 10.1007/s10875-009-9295-7. Epub 2009 May 12.
2 Deficiency of the beta subunit of the eighth component of complement presenting as arthritis and exanthem.Arthritis Rheum. 1994 Nov;37(11):1704-6. doi: 10.1002/art.1780371121.
3 Genetic basis of human complement C8 beta deficiency.J Immunol. 1993 Jun 1;150(11):4943-7.
4 Time course of complement activation and inhibitor expression after ischemic injury of rat myocardium.Am J Pathol. 1994 Jun;144(6):1357-68.
5 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
6 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
7 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
8 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
9 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
10 Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
11 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.