Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHKIB62)

DOT Name	Glycosyl-phosphatidylinositol-anchored molecule-like protein (GML)
Gene Name	GML
Related Disease	Advanced cancer ( ) Carcinoma of esophagus ( ) Esophageal cancer ( ) Neoplasm of esophagus ( ) Cardiovascular disease ( ) Congenital adrenal hyperplasia due to 11-beta-hydroxylase deficiency ( ) High blood pressure ( ) Non-small-cell lung cancer ( ) Acute lymphocytic leukaemia ( ) Colorectal carcinoma ( ) Lymphoid leukemia ( )
UniProt ID	GML_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MLLFALLLAMELPLVAASATMRAQWTYSLRCHDCAVINDFNCPNIRVCPYHIRRCMTISI RINSRELLVYKNCTNNCTFVYAAEQPPEAPGKIFKTNSFYWVCCCNSMVCNAGGPTNLER DMLPDEVTEEELPEGTVRLGVSKLLLSFASIIVSNILP
Function	May play a role in the apoptotic pathway or cell-cycle regulation induced by p53/TP53 after DNA damage.

Molecular Interaction Atlas (MIA) of This DOT

11 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Advanced cancer	DISAT1Z9	Definitive	Biomarker	[1]
Carcinoma of esophagus	DISS6G4D	Definitive	Altered Expression	[2]
Esophageal cancer	DISGB2VN	Definitive	Altered Expression	[2]
Neoplasm of esophagus	DISOLKAQ	Definitive	Altered Expression	[2]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[3]
Congenital adrenal hyperplasia due to 11-beta-hydroxylase deficiency	DISBTYRN	Strong	CausalMutation	[4]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[5]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[6]
Acute lymphocytic leukaemia	DISPX75S	Limited	Biomarker	[7]
Colorectal carcinoma	DIS5PYL0	Limited	Altered Expression	[8]
Lymphoid leukemia	DIS65TYQ	Limited	Biomarker	[7]
------------------------------------------------------------------------------------


⏷ Show the Full List of 11 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Glycosyl-phosphatidylinositol-anchored molecule-like protein (GML).	[9]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Glycosyl-phosphatidylinositol-anchored molecule-like protein (GML).	[11]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Glycosyl-phosphatidylinositol-anchored molecule-like protein (GML).	[10]
------------------------------------------------------------------------------------

References

1	Induction of apoptosis in T98G glioblastoma cells by transfection of GML, a p53 target gene.Oncol Res. 1999;11(3):125-32.
2	Overexpression of GML promotes radiation-induced cell cycle arrest and apoptosis.Biochem Biophys Res Commun. 1997 Dec 18;241(2):481-5. doi: 10.1006/bbrc.1997.7818.
3	Leveraging Polygenic Functional Enrichment to Improve GWAS Power.Am J Hum Genet. 2019 Jan 3;104(1):65-75. doi: 10.1016/j.ajhg.2018.11.008. Epub 2018 Dec 27.
4	Clinical, genetic, and structural basis of congenital adrenal hyperplasia due to 11-hydroxylase deficiency.Proc Natl Acad Sci U S A. 2017 Mar 7;114(10):E1933-E1940. doi: 10.1073/pnas.1621082114. Epub 2017 Feb 22.
5	Interethnic analyses of blood pressure loci in populations of East Asian and European descent.Nat Commun. 2018 Nov 28;9(1):5052. doi: 10.1038/s41467-018-07345-0.
6	p53-regulated GML gene expression in non-small cell lung cancer. a promising relationship to cisplatin chemosensitivity.Eur J Cancer. 2000 Mar;36(4):489-95. doi: 10.1016/s0959-8049(99)00261-0.
7	Philadelphia chromosome positive chronic myelogenous leukemia developing in a patient with acute lymphoblastic leukemia.Cancer. 1979 May;43(5):1782-7. doi: 10.1002/1097-0142(197905)43:5<1782::aid-cncr2820430531>3.0.co;2-j.
8	The potential clinical value of GML and the p53 gene as a predictor of chemosensitivity for colorectal cancer.Int J Clin Oncol. 2001 Apr;6(2):90-6. doi: 10.1007/pl00012089.
9	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
10	Quercetin and Its Fermented Extract as a Potential Inhibitor of Bisphenol A-Exposed HT-29 Colon Cancer Cells' Viability. Int J Mol Sci. 2023 Mar 15;24(6):5604. doi: 10.3390/ijms24065604.
11	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.