Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHZ3E6T)

• DOT Name: Ribonuclease P protein subunit p25-like protein (RPP25L)
• Synonyms: RNase P protein subunit-like p25; Rpp25-like protein
• Gene Name: RPP25L
• UniProt ID: RP25L_HUMAN
• Pfam ID: PF01918
• Sequence:
  MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGS
  GRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVL
  LSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS
• Function: May be a component of ribonuclease P or MRP.
• KEGG Pathway: Ribosome biogenesis in eukaryotes (hsa03008)

Molecular Interaction Atlas (MIA) of This DOT

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Ribonuclease P protein subunit p25-like protein (RPP25L).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Ribonuclease P protein subunit p25-like protein (RPP25L).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Ribonuclease P protein subunit p25-like protein (RPP25L).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Ribonuclease P protein subunit p25-like protein (RPP25L).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Ribonuclease P protein subunit p25-like protein (RPP25L).	[5]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Ribonuclease P protein subunit p25-like protein (RPP25L).	[6]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Ribonuclease P protein subunit p25-like protein (RPP25L).	[5]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Ribonuclease P protein subunit p25-like protein (RPP25L).	[7]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Ribonuclease P protein subunit p25-like protein (RPP25L).	[9]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Ribonuclease P protein subunit p25-like protein (RPP25L).	[8]

References

• [1] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [6] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [7] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [8] Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.
• [9] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.