Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTI4YS3Y)

• DOT Name: Interleukin-13 (IL13)
• Synonyms: IL-13
• Gene Name: IL13
• UniProt ID: IL13_HUMAN
• PDB ID: 1GA3; 1IJZ; 1IK0; 3BPO; 3G6D; 3L5W; 3L5X; 3LB6; 4I77; 4PS4; 5E4E; 5L6Y
• Pfam ID: PF03487
• Sequence:
  MHPLLNPLLLALGLMALLLTTVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAP
  LCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRD
  TKIEVAQFVKDLLLHLKKLFREGQFN
• Function: Cytokine that plays important roles in allergic inflammation and immune response to parasite infection. Synergizes with IL2 in regulating interferon-gamma synthesis. Stimulates B-cell proliferation, and activation of eosinophils, basophils, and mast cells. Plays an important role in controlling IL33 activity by modulating the production of transmembrane and soluble forms of interleukin-1 receptor-like 1/IL1RL1. Displays the capacity to antagonize Th1-driven proinflammatory immune response and downregulates synthesis of many proinflammatory cytokines including IL1, IL6, IL10, IL12 and TNF-alpha through a mechanism that partially involves suppression of NF-kappa-B. Functions also on nonhematopoietic cells, including endothelial cells where it induces vascular cell adhesion protein 1/VCAM1, which is important in the recruitment of eosinophils. Exerts its biological effects through its receptors which comprises the IL4R chain and the IL13RA1 chain, to activate JAK1 and TYK2, leading to the activation of STAT6. Aside from IL13RA1, another receptor IL13RA2 acts as a high affinity decoy for IL13 and mediates internalization and depletion of extracellular IL13.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  JAK-STAT sig.ling pathway (hsa04630)
  IL-17 sig.ling pathway (hsa04657)
  Th1 and Th2 cell differentiation (hsa04658)
  Fc epsilon RI sig.ling pathway (hsa04664)
  Pathways in cancer (hsa05200)
  Asthma (hsa05310)
  Inflammatory bowel disease (hsa05321)
• Reactome Pathway:
  Interleukin-18 signaling (R-HSA-9012546)
  Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Aspirin	DM672AH	Approved	Interleukin-13 (IL13) affects the response to substance of Aspirin.	[25]
PMID28460551-Compound-2	DM4DOUB	Patented	Interleukin-13 (IL13) affects the response to substance of PMID28460551-Compound-2.	[26]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Interleukin-13 (IL13).	[1]
Arsenic	DMTL2Y1	Approved	Arsenic increases the methylation of Interleukin-13 (IL13).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Interleukin-13 (IL13).	[19]

20 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Interleukin-13 (IL13).	[2]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Interleukin-13 (IL13).	[4]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Interleukin-13 (IL13).	[5]
Malathion	DMXZ84M	Approved	Malathion increases the expression of Interleukin-13 (IL13).	[7]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of Interleukin-13 (IL13).	[8]
Alitretinoin	DMME8LH	Approved	Alitretinoin increases the expression of Interleukin-13 (IL13).	[2]
Budesonide	DMJIBAW	Approved	Budesonide increases the activity of Interleukin-13 (IL13).	[11]
Prednisone	DM2HG4X	Approved	Prednisone decreases the expression of Interleukin-13 (IL13).	[13]
Epinastine	DMX0K3Q	Approved	Epinastine decreases the expression of Interleukin-13 (IL13).	[14]
Beclomethasone dipropionate	DM5NW1E	Phase 4	Beclomethasone dipropionate increases the activity of Interleukin-13 (IL13).	[11]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Interleukin-13 (IL13).	[15]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Interleukin-13 (IL13).	[17]
Etazolate	DMOCID7	Phase 2	Etazolate decreases the expression of Interleukin-13 (IL13).	[18]
PMID28870136-Compound-48	DMPIM9L	Patented	PMID28870136-Compound-48 decreases the expression of Interleukin-13 (IL13).	[18]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of Interleukin-13 (IL13).	[20]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of Interleukin-13 (IL13).	[21]
Forskolin	DM6ITNG	Investigative	Forskolin decreases the expression of Interleukin-13 (IL13).	[18]
Chlorpyrifos	DMKPUI6	Investigative	Chlorpyrifos increases the expression of Interleukin-13 (IL13).	[22]
Aminohippuric acid	DMUN54G	Investigative	Aminohippuric acid increases the expression of Interleukin-13 (IL13).	[23]
ROLIPRAM	DMJ03UM	Investigative	ROLIPRAM decreases the expression of Interleukin-13 (IL13).	[18]

9 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the secretion of Interleukin-13 (IL13).	[6]
Rifampicin	DM5DSFZ	Approved	Rifampicin increases the secretion of Interleukin-13 (IL13).	[9]
Dinoprostone	DMTYOPD	Approved	Dinoprostone increases the secretion of Interleukin-13 (IL13).	[10]
Pomalidomide	DMTGBAX	Approved	Pomalidomide decreases the secretion of Interleukin-13 (IL13).	[12]
Ethambutol	DMR87LC	Approved	Ethambutol increases the secretion of Interleukin-13 (IL13).	[9]
Fidarestat	DMZL1I8	Phase 3	Fidarestat decreases the response to substance of Interleukin-13 (IL13).	[16]
[3H]NECA	DMAO9SH	Investigative	[3H]NECA increases the secretion of Interleukin-13 (IL13).	[24]
EHNA	DM014WS	Investigative	EHNA increases the secretion of Interleukin-13 (IL13).	[24]
8-sulfophenyl theophylline	DMOHB3Z	Investigative	8-sulfophenyl theophylline decreases the secretion of Interleukin-13 (IL13).	[24]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Direct and indirect effects of retinoic acid on human Th2 cytokine and chemokine expression by human T lymphocytes. BMC Immunol. 2006 Nov 21;7:27. doi: 10.1186/1471-2172-7-27.
• [3] Transcriptomics and methylomics of CD4-positive T cells in arsenic-exposed women. Arch Toxicol. 2017 May;91(5):2067-2078. doi: 10.1007/s00204-016-1879-4. Epub 2016 Nov 12.
• [4] Inhibition of interleukin-13 gene expression in T cells through GATA-3 pathway by arsenic trioxide. Chin Med J (Engl). 2008 Nov 20;121(22):2346-9.
• [5] Benzyl isothiocyanate attenuates the hydrogen peroxide-induced interleukin-13 expression through glutathione S-transferase P induction in T lymphocytic leukemia cells. J Biochem Mol Toxicol. 2018 Jun;32(6):e22054.
• [6] Editor's Highlight: Modeling Compound-Induced Fibrogenesis In Vitro Using Three-Dimensional Bioprinted Human Liver Tissues. Toxicol Sci. 2016 Dec;154(2):354-367. doi: 10.1093/toxsci/kfw169. Epub 2016 Sep 7.
• [7] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [8] Metronomic gemcitabine suppresses tumour growth, improves perfusion, and reduces hypoxia in human pancreatic ductal adenocarcinoma. Br J Cancer. 2010 Jun 29;103(1):52-60.
• [9] Detection of Drug-Responsive T-Lymphocytes in a Case of Fatal Antituberculosis Drug-Related Liver Injury. Chem Res Toxicol. 2016 Nov 21;29(11):1793-1795. doi: 10.1021/acs.chemrestox.6b00393. Epub 2016 Nov 9.
• [10] Etiopathogenesis of atopic dermatitis--an overview. Acta Dermatovenerol Croat. 2005;13(1):54-62.
• [11] [Effects of beclomethasone dipropionate and budesonide on interleukin-13 induced cytokine release, proliferation and differentiation of the human lung fibroblasts]. Zhonghua Jie He He Hu Xi Za Zhi. 2007 Aug;30(8):599-604.
• [12] Immunomodulatory derivative of thalidomide (IMiD CC-4047) induces a shift in lineage commitment by suppressing erythropoiesis and promoting myelopoiesis. Blood. 2005 May 15;105(10):3833-40. doi: 10.1182/blood-2004-03-0828. Epub 2004 Aug 3.
• [13] Alterations in eotaxin, monocyte chemoattractant protein-4, interleukin-5, and interleukin-13 after systemic steroid treatment for nasal polyps. Otolaryngol Head Neck Surg. 2004 Nov;131(5):585-9. doi: 10.1016/j.otohns.2004.05.028.
• [14] Epinastine hydrochloride antagonism against interleukin-4-mediated T cell cytokine imbalance in vitro. Int Arch Allergy Immunol. 2006;140(1):43-52. doi: 10.1159/000092001. Epub 2006 Mar 13.
• [15] Grape resveratrol increases serum adiponectin and downregulates inflammatory genes in peripheral blood mononuclear cells: a triple-blind, placebo-controlled, one-year clinical trial in patients with stable coronary artery disease. Cardiovasc Drugs Ther. 2013 Feb;27(1):37-48. doi: 10.1007/s10557-012-6427-8.
• [16] Aldose reductase inhibition prevents metaplasia of airway epithelial cells. PLoS One. 2010 Dec 28;5(12):e14440. doi: 10.1371/journal.pone.0014440.
• [17] Modulation of histidine decarboxylase activity and cytokine synthesis in human leukemic cell lines: relationship with basophilic and/or megakaryocytic differentiation. Exp Hematol. 1999 Aug;27(8):1295-305. doi: 10.1016/s0301-472x(99)00070-3.
• [18] Global expression profiling of theophylline response genes in macrophages: evidence of airway anti-inflammatory regulation. Respir Res. 2005 Aug 8;6(1):89. doi: 10.1186/1465-9921-6-89.
• [19] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [20] Linking site-specific loss of histone acetylation to repression of gene expression by the mycotoxin ochratoxin A. Arch Toxicol. 2018 Feb;92(2):995-1014.
• [21] Paraquat exposure induces Parkinsonism by altering lipid profile and evoking neuroinflammation in the midbrain. Environ Int. 2022 Nov;169:107512. doi: 10.1016/j.envint.2022.107512. Epub 2022 Sep 8.
• [22] Effects of the organophosphate insecticides phosmet and chlorpyrifos on trophoblast JEG-3 cell death, proliferation and inflammatory molecule production. Toxicol In Vitro. 2012 Apr;26(3):406-13. doi: 10.1016/j.tiv.2012.01.003. Epub 2012 Jan 12.
• [23] Childhood exposure to ambient polycyclic aromatic hydrocarbons is linked to epigenetic modifications and impaired systemic immunity in T cells. Clin Exp Allergy. 2015 Jan;45(1):238-48. doi: 10.1111/cea.12377.
• [24] Adenosine deaminase 1 and concentrative nucleoside transporters 2 and 3 regulate adenosine on the apical surface of human airway epithelia: implications for inflammatory lung diseases. Biochemistry. 2007 Sep 11;46(36):10373-83. doi: 10.1021/bi7009647. Epub 2007 Aug 15.
• [25] IL-13 and IL-17A gene polymorphisms in Japanese patients with aspirin-exacerbated respiratory disease. Ann Allergy Asthma Immunol. 2011 Dec;107(6):510-6. doi: 10.1016/j.anai.2011.09.003. Epub 2011 Sep 22.
• [26] Association of single nucleotide polymorphisms in IL8 and IL13 with sunitinib-induced toxicity in patients with metastatic renal cell carcinoma. Eur J Clin Pharmacol. 2015 Dec;71(12):1477-84. doi: 10.1007/s00228-015-1935-7. Epub 2015 Sep 21.