Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIG8TR5)

• DOT Name: Cilia- and flagella-associated protein 20 (CFAP20)
• Synonyms: Basal body up-regulated protein 22; Transcription factor IIB
• Gene Name: CFAP20
• Related Disease:
  Breast cancer
  Breast carcinoma
  Hepatocellular carcinoma
  Metastatic malignant neoplasm
• UniProt ID: CFA20_HUMAN
• PDB ID: 7UNG; 8J07
• Pfam ID: PF05018
• Sequence:
  MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYIT
  CPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICT
  MPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAE
  FKLYLPVQNKAKQ
• Function: Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in cilia axoneme, which is required for motile cilia beating. Involved in the regulation of the size and morphology of cilia. Required for axonemal microtubules polyglutamylation.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Strong	Altered Expression	[1]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[1]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[2]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[3]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Cilia- and flagella-associated protein 20 (CFAP20).	[4]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Cilia- and flagella-associated protein 20 (CFAP20).	[5]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Cilia- and flagella-associated protein 20 (CFAP20).	[6]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Cilia- and flagella-associated protein 20 (CFAP20).	[7]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Cilia- and flagella-associated protein 20 (CFAP20).	[8]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Cilia- and flagella-associated protein 20 (CFAP20).	[9]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Cilia- and flagella-associated protein 20 (CFAP20).	[10]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Cilia- and flagella-associated protein 20 (CFAP20).	[11]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Cilia- and flagella-associated protein 20 (CFAP20).	[12]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Cilia- and flagella-associated protein 20 (CFAP20).	[13]

References

• [1] Prognostic Value of the Expression of DNA Repair-Related Biomarkers Mediated by Alcohol in Gastric Cancer Patients.Am J Pathol. 2018 Feb;188(2):367-377. doi: 10.1016/j.ajpath.2017.10.010. Epub 2018 Jan 10.
• [2] Transcriptional regulation of human transcription factor IIB in SMMC-7721 human hepatocellular carcinoma cells by all-trans-retinoic acid and phorbol 12-myristate 13-acetate.J Cancer Res Clin Oncol. 1998;124(9):493-6. doi: 10.1007/s004320050204.
• [3] Analysis of tumor progression by transcriptional profiling of mouse MK16 cell lines transformed with human papillomavirus type 16 E6 and E7 oncogenes and activated H-ras.Oncol Rep. 2005 Dec;14(6):1665-74.
• [4] A genomic approach to predict synergistic combinations for breast cancer treatment. Pharmacogenomics J. 2013 Feb;13(1):94-104. doi: 10.1038/tpj.2011.48. Epub 2011 Nov 15.
• [5] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [6] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [7] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [8] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [9] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [10] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [11] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [12] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [13] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.