Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJJPZOZ)

DOT Name Cadherin-like and PC-esterase domain-containing protein 1 (CPED1)
Gene Name CPED1
Related Disease
Becker muscular dystrophy ( )
Breast cancer ( )
Breast carcinoma ( )
Coffin-Siris syndrome ( )
Creutzfeldt Jacob disease ( )
Inherited Creutzfeldt-Jakob disease ( )
Non-insulin dependent diabetes ( )
Vitelliform macular dystrophy ( )
Anxiety disorder ( )
Autism ( )
UniProt ID
CPED1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF12733
Sequence
MVCRPVFPCRRRFCPRPFLVGLVVAICLFYQTLTLRGSRKLTAAAPGAVPHTSTETQASR
CKKGFSQDKQCFLLSGNAQETRKVKESMETHFGSHGRRAILYRPPFYSKTELQLHQHILT
QHGYTVVIAEERLNAGLGPGLLEQGDLGSWDLLICLSSKKAEGTPCISKEVMCQLGLHQK
ANRLPEIQQPLCRKEGLCQIVRRFPELQLPVSPSVCLDQGMQLKPSTSSHLLKTVKPRVW
KPGDWSREQLNETTVLAPHETIFRAEDLSVILKAYVLVTSLTPLRAFIHSTGTVWNPPKK
KRFTVKLQTFFETFLRASSPQQAFDIMKEAIGKLLLAAEVFSETSTLGPKTFHRCRFCFQ
LLTFDIGYGSFMYPVVLQVHEHLNFQDYDNMDFEDQNTEEFLLNDTFNFLFPNESSLSIF
SEIFQRLYRSDVFKGENYQKELNQCLSLEEINSIMTFIKELGSLGQFQLLFPSTTPGIQS
LMHEFYDVANPVGNPGSVLTQYWSLLNVFEQFQFMNKKTQPHPLEWNSFTEDKNIEKPQV
PFDAIENKKAAVPQIKNENKEIHCSDDENTPCHIKQIFTHPHLELNPDFHPKIKDYYCEV
PFDVVTVTIGVETPKCLCKVHLYEQAGPSFASYPLGLGMNKISIFVVDESPAHGETLITY
KLTIYREDRPSLPLFEAFTACGFVQDCGLLIHPEETCGLQPISSDYIEAILQSELKRCPS
GDMKGQWIVPCLSCSDNRTCDWREITWQPHNCQYGVLTKPQLQQCLGGRKILFIGDSTNR
GIMYYLIERLNETLQEWQKVHGTKFYHNVNGGKTLISYSYYPQFWISPSLRPTFENALEH
LLQRSRPLENTGQTVLVVGGVQWLNSNHLQIIHKVLKRENLLNILVIIKTLGIGFHLPVD
GVHFLTQSEVQNLWKENLIILDTAKKHGYEVVDTFTITMGRYKEFLQGKCGCHFHEVVKS
KLSKEYNFIKMKRSRNHIMGRYFSNQSKLQQGTVTNFRSPYHVRGPINQVCSEILLSRMC
ANKRTM

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Becker muscular dystrophy DIS5IYHL Strong Biomarker [1]
Breast cancer DIS7DPX1 Strong Biomarker [2]
Breast carcinoma DIS2UE88 Strong Biomarker [2]
Coffin-Siris syndrome DIS8L03H Strong Genetic Variation [3]
Creutzfeldt Jacob disease DISCB6RX Strong Biomarker [4]
Inherited Creutzfeldt-Jakob disease DIS3TXG8 Strong Biomarker [4]
Non-insulin dependent diabetes DISK1O5Z Strong Genetic Variation [5]
Vitelliform macular dystrophy DISEFYYN Strong Biomarker [1]
Anxiety disorder DISBI2BT Limited Genetic Variation [6]
Autism DISV4V1Z Limited Genetic Variation [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Cadherin-like and PC-esterase domain-containing protein 1 (CPED1). [7]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Cadherin-like and PC-esterase domain-containing protein 1 (CPED1). [8]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Cadherin-like and PC-esterase domain-containing protein 1 (CPED1). [9]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Cadherin-like and PC-esterase domain-containing protein 1 (CPED1). [10]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Cadherin-like and PC-esterase domain-containing protein 1 (CPED1). [11]
Quercetin DM3NC4M Approved Quercetin increases the expression of Cadherin-like and PC-esterase domain-containing protein 1 (CPED1). [12]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Cadherin-like and PC-esterase domain-containing protein 1 (CPED1). [13]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Cadherin-like and PC-esterase domain-containing protein 1 (CPED1). [15]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Cadherin-like and PC-esterase domain-containing protein 1 (CPED1). [13]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Cadherin-like and PC-esterase domain-containing protein 1 (CPED1). [16]
Sulforaphane DMQY3L0 Investigative Sulforaphane decreases the expression of Cadherin-like and PC-esterase domain-containing protein 1 (CPED1). [17]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Cadherin-like and PC-esterase domain-containing protein 1 (CPED1). [14]
------------------------------------------------------------------------------------

References

1 Meta-analysis of genome-wide scans for total body BMD in children and adults reveals allelic heterogeneity and age-specific effects at the WNT16 locus.PLoS Genet. 2012 Jul;8(7):e1002718. doi: 10.1371/journal.pgen.1002718. Epub 2012 Jul 5.
2 Enhanced Identification of Potential Pleiotropic Genetic Variants for Bone Mineral Density and Breast Cancer.Calcif Tissue Int. 2017 Nov;101(5):489-500. doi: 10.1007/s00223-017-0308-x. Epub 2017 Jul 31.
3 Duplication of C7orf58, WNT16 and FAM3C in an obese female with a t(7;22)(q32.1;q11.2) chromosomal translocation and clinical features resembling Coffin-Siris Syndrome.PLoS One. 2012;7(12):e52353. doi: 10.1371/journal.pone.0052353. Epub 2012 Dec 27.
4 Snord 3A: a molecular marker and modulator of prion disease progression.PLoS One. 2013;8(1):e54433. doi: 10.1371/journal.pone.0054433. Epub 2013 Jan 21.
5 Pilot genome-wide association study identifying novel risk loci for type 2 diabetes in a Maya population.Gene. 2018 Nov 30;677:324-331. doi: 10.1016/j.gene.2018.08.041. Epub 2018 Aug 18.
6 A complex chromosome 7q rearrangement identified in a patient with mental retardation, anxiety disorder, and autistic features.Am J Med Genet A. 2010 Feb;152A(2):427-33. doi: 10.1002/ajmg.a.33203.
7 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
8 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
9 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
10 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
11 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
12 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
13 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
14 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
15 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
16 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
17 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.