Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJY2N6U)

• DOT Name: Peptidase inhibitor 16 (PI16)
• Synonyms: PI-16; Cysteine-rich secretory protein 9; CRISP-9; PSP94-binding protein; CD antigen CD364
• Gene Name: PI16
• Related Disease:
  Type-1 diabetes
  Prostate cancer
  Prostate carcinoma
  Prostate neoplasm
  Acute myelogenous leukaemia
• UniProt ID: PI16_HUMAN
• Pfam ID: PF00188
• Sequence:
  MHGSCSFLMLLLPLLLLLVATTGPVGALTDEEKRLMVELHNLYRAQVSPTASDMLHMRWD
  EELAAFAKAYARQCVWGHNKERGRRGENLFAITDEGMDVPLAMEEWHHEREHYNLSAATC
  SPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEG
  TPCSQCPSGYHCKNSLCEPIGSPEDAQDLPYLVTEAPSFRATEASDSRKMGTPSSLATGI
  PAFLVTEVSGSLATKALPAVETQAPTSLATKDPPSMATEAPPCVTTEVPSILAAHSLPSL
  DEEPVTFPKSTHVPIPKSADKVTDKTKVPSRSPENSLDPKMSLTGARELLPHAQEEAEAE
  AELPPSSEVLASVFPAQDKPGELQATLDHTGHTSSKSLPNFPNTSATANATGGRALALQS
  SLPGAEGPDKPSVVSGLNSGPGHVWGPLLGLLLLPPLVLAGIF
• Function: May inhibit cardiomyocyte growth.
• Tissue Specificity: Expressed in prostate, testis, ovary and intestine. Concentrates in prostate cancer patient's sera.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Type-1 diabetes	DIS7HLUB	Definitive	Biomarker	[1]
Prostate cancer	DISF190Y	Strong	Altered Expression	[2]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[2]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[3]
Acute myelogenous leukaemia	DISCSPTN	moderate	Genetic Variation	[4]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Peptidase inhibitor 16 (PI16).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Peptidase inhibitor 16 (PI16).	[6]

References

• [1] Peptidase inhibitor 16 identifies a human regulatory T-cell subset with reduced FOXP3 expression over the first year of recent onset type 1 diabetes.Eur J Immunol. 2019 Aug;49(8):1235-1250. doi: 10.1002/eji.201948094. Epub 2019 Jun 5.
• [2] Identification, purification and characterization of a novel human blood protein with binding affinity for prostate secretory protein of 94 amino acids.Biochem J. 2005 Jan 1;385(Pt 1):105-14. doi: 10.1042/BJ20040290.
• [3] Prognostic value of prostate secretory protein of 94 amino acids and its binding protein after radical prostatectomy.Clin Cancer Res. 2006 Oct 15;12(20 Pt 1):6018-22. doi: 10.1158/1078-0432.CCR-06-0625.
• [4] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [5] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.