Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTK8674M)

DOT Name G-protein coupled receptor 15 (GPR15)
Synonyms Brother of Bonzo; BoB
Gene Name GPR15
Related Disease
Cardiovascular disease ( )
Chronic obstructive pulmonary disease ( )
Colitis ( )
Gastric adenocarcinoma ( )
HIV infectious disease ( )
Psoriasis ( )
Rheumatoid arthritis ( )
Ulcerative colitis ( )
Inflammation ( )
Pneumonia ( )
UniProt ID
GPR15_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00001
Sequence
MDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHF
KPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCS
VLLLTCMSVDRYLAIVWPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDK
PYCAEKKATPIKLIWSLVALIFTFFVPLLSIVTCYCCIARKLCAHYQQSGKHNKKLKKSI
KIIFIVVAAFLVSWLPFNTFKFLAIVSGLRQEHYLPSAILQLGMEVSGPLAFANSCVNPF
IYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFARRRKRSVSL
Function Probable chemokine receptor. Alternative coreceptor with CD4 for HIV-1 infection.
Reactome Pathway
G alpha (s) signalling events (R-HSA-418555 )

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cardiovascular disease DIS2IQDX Strong Genetic Variation [1]
Chronic obstructive pulmonary disease DISQCIRF Strong Altered Expression [2]
Colitis DISAF7DD Strong Biomarker [3]
Gastric adenocarcinoma DISWWLTC Strong Biomarker [2]
HIV infectious disease DISO97HC Strong Biomarker [2]
Psoriasis DIS59VMN Strong Biomarker [4]
Rheumatoid arthritis DISTSB4J Strong Biomarker [5]
Ulcerative colitis DIS8K27O Strong Altered Expression [6]
Inflammation DISJUQ5T Limited Genetic Variation [7]
Pneumonia DIS8EF3M Limited Biomarker [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of G-protein coupled receptor 15 (GPR15). [9]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of G-protein coupled receptor 15 (GPR15). [10]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of G-protein coupled receptor 15 (GPR15). [11]
------------------------------------------------------------------------------------

References

1 Novel DNA Methylation Sites Influence GPR15 Expression in Relation to Smoking.Biomolecules. 2018 Aug 20;8(3):74. doi: 10.3390/biom8030074.
2 An Integrated Pan-Cancer Analysis and Structure-Based Virtual Screening of GPR15.Int J Mol Sci. 2019 Dec 10;20(24):6226. doi: 10.3390/ijms20246226.
3 Role and species-specific expression of colon T cell homing receptor GPR15 in colitis.Nat Immunol. 2015 Feb;16(2):207-213. doi: 10.1038/ni.3079. Epub 2014 Dec 22.
4 GPR15 is not critically involved in the regulation of murine psoriasiform dermatitis.J Dermatol Sci. 2019 Apr;94(1):196-204. doi: 10.1016/j.jdermsci.2019.01.008. Epub 2019 Mar 12.
5 RNA sequencing to predict response to TNF- inhibitors reveals possible mechanism for nonresponse in smokers.Expert Rev Clin Immunol. 2018 Jul;14(7):623-633. doi: 10.1080/1744666X.2018.1480937. Epub 2018 Jun 6.
6 Differential expression of GPR15 on T cells during ulcerative colitis.JCI Insight. 2017 Apr 20;2(8):e90585. doi: 10.1172/jci.insight.90585. eCollection 2017 Apr 20.
7 Methylation of MTHFR Moderates the Effect of Smoking on Genomewide Methylation Among Middle Age African Americans.Front Genet. 2018 Dec 10;9:622. doi: 10.3389/fgene.2018.00622. eCollection 2018.
8 Tobacco-smoking induced GPR15-expressing T cells in blood do not indicate pulmonary damage.BMC Pulm Med. 2017 Nov 28;17(1):159. doi: 10.1186/s12890-017-0509-0.
9 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
10 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
11 Genome-wide transcriptional and functional analysis of human T lymphocytes treated with benzo[alpha]pyrene. Int J Mol Sci. 2018 Nov 17;19(11).