Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTK8ULTH)

• DOT Name: Saitohin (STH)
• Gene Name: STH
• Related Disease:
  Dementia
  Frontotemporal dementia
  Huntington disease
  Intestinal disorder
  Irritable bowel syndrome
  Late-onset Parkinson disease
  Mental disorder
  Pick disease
  Primary biliary cholangitis
  Schizophrenia
  Tauopathy
  Parkinson disease
  Progressive supranuclear palsy
  Schistosomiasis
• UniProt ID: STH_HUMAN
• Sequence:
  MSEGGGQVSCIFAAPTRLCRWPALIECGVNLTQPLCEWMIQVARDRTLSLAWEVASLLTL
  SSSEVGLEGVGTIWPSSYSSEESSRNGAEQGRQLSIEGPFQGQNCPSHPAAALPLPMRGE
  SQATSCQV
• Tissue Specificity: Highest expression in placenta, muscle, fetal brain, and adult brain, with lower expression in heart, kidney, stomach, testis, and adrenal gland. In the central nervous system, highest expression is in temporal lobe, hypothalamus, medulla and spinal cord, with lower expression in other brain regions.

Molecular Interaction Atlas (MIA) of This DOT

14 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Dementia	DISXL1WY	Strong	Genetic Variation	[1]
Frontotemporal dementia	DISKYHXL	Strong	Genetic Variation	[2]
Huntington disease	DISQPLA4	Strong	Genetic Variation	[3]
Intestinal disorder	DISGPMUQ	Strong	Altered Expression	[4]
Irritable bowel syndrome	DIS27206	Strong	Altered Expression	[4]
Late-onset Parkinson disease	DIS9IOUI	Strong	Genetic Variation	[5]
Mental disorder	DIS3J5R8	Strong	Genetic Variation	[6]
Pick disease	DISP6X50	Strong	Genetic Variation	[2]
Primary biliary cholangitis	DIS43E0O	Strong	Genetic Variation	[7]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[6]
Tauopathy	DISY2IPA	Strong	Genetic Variation	[8]
Parkinson disease	DISQVHKL	moderate	Genetic Variation	[5]
Progressive supranuclear palsy	DISO5KRQ	moderate	Altered Expression	[9]
Schistosomiasis	DIS6PD44	Limited	Biomarker	[10]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Malathion	DMXZ84M	Approved	Malathion increases the expression of Saitohin (STH).	[11]

References

• [1] Serotonin transporter and saitohin genes in risk of Alzheimer's disease and frontotemporal lobar dementia: preliminary findings.Neurol Sci. 2010 Dec;31(6):741-9. doi: 10.1007/s10072-010-0400-8. Epub 2010 Sep 18.
• [2] Saitohin polymorphism and executive dysfunction in schizophrenia.Neurol Sci. 2012 Oct;33(5):1051-6. doi: 10.1007/s10072-011-0893-9. Epub 2011 Dec 21.
• [3] HD phenocopies--possible role of Saitohin gene.Int J Neurosci. 2008 Mar;118(3):391-7. doi: 10.1080/00207450701593103.
• [4] 21st century research in urban WASH and health in sub-Saharan Africa: methods and outcomes in transition.Int J Environ Health Res. 2019 Aug;29(4):457-478. doi: 10.1080/09603123.2018.1550193. Epub 2018 Dec 13.
• [5] Association of rs62063857 variant of the saitohin gene with Parkinson's disease.Cell Mol Neurobiol. 2015 Jan;35(1):115-21. doi: 10.1007/s10571-014-0102-5. Epub 2014 Aug 29.
• [6] COMT and STH polymorphisms interaction on cognition in schizophrenia.Neurol Sci. 2015 Feb;36(2):215-20. doi: 10.1007/s10072-014-1936-9. Epub 2014 Oct 5.
• [7] Dense fine-mapping study identifies new susceptibility loci for primary biliary cirrhosis.Nat Genet. 2012 Oct;44(10):1137-41. doi: 10.1038/ng.2395. Epub 2012 Sep 9.
• [8] The Q7R Saitohin gene polymorphism is not associated with Alzheimer disease.Neurosci Lett. 2003 Aug 28;347(3):143-6. doi: 10.1016/s0304-3940(03)00670-0.
• [9] Tau and saitohin gene expression pattern in progressive supranuclear palsy.Brain Res. 2007 May 11;1145:168-76. doi: 10.1016/j.brainres.2007.01.098. Epub 2007 Feb 1.
• [10] Mapping Soil Transmitted Helminths and Schistosomiasis under Uncertainty: A Systematic Review and Critical Appraisal of Evidence.PLoS Negl Trop Dis. 2016 Dec 22;10(12):e0005208. doi: 10.1371/journal.pntd.0005208. eCollection 2016 Dec.
• [11] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.