Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKPM0Z5)

DOT Name Nucleolar protein 14 (NOP14)
Synonyms Nucleolar complex protein 14
Gene Name NOP14
Related Disease
Advanced cancer ( )
Matthew-Wood syndrome ( )
Pancreatic cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Invasive breast carcinoma ( )
Melanocytic nevus ( )
Melanoma ( )
Neoplasm ( )
UniProt ID
NOP14_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF04147
Sequence
MAKAKKVGARRKASGAPAGARGGPAKANSNPFEVKVNRQKFQILGRKTRHDVGLPGVSRA
RALRKRTQTLLKEYKERDKSNVFRDKRFGEYNSNMSPEEKMMKRFALEQQRHHEKKSIYN
LNEDEELTHYGQSLADIEKHNDIVDSDSDAEDRGTLSAELTAAHFGGGGGLLHKKTQQEG
EEREKPKSRKELIEELIAKSKQEKRERQAQREDALELTEKLDQDWKEIQTLLSHKTPKSE
NRDKKEKPKPDAYDMMVRELGFEMKAQPSNRMKTEAELAKEEQEHLRKLEAERLRRMLGK
DEDENVKKPKHMSADDLNDGFVLDKDDRRLLSYKDGKMNVEEDVQEEQSKEASDPESNEE
EGDSSGGEDTEESDSPDSHLDLESNVESEEENEKPAKEQRQTPGKGLISGKERAGKATRD
ELPYTFAAPESYEELRSLLLGRSMEEQLLVVERIQKCNHPSLAEGNKAKLEKLFGFLLEY
VGDLATDDPPDLTVIDKLVVHLYHLCQMFPESASDAIKFVLRDAMHEMEEMIETKGRAAL
PGLDVLIYLKITGLLFPTSDFWHPVVTPALVCLSQLLTKCPILSLQDVVKGLFVCCLFLE
YVALSQRFIPELINFLLGILYIATPNKASQGSTLVHPFRALGKNSELLVVSAREDVATWQ
QSSLSLRWASRLRAPTSTEANHIRLSCLAVGLALLKRCVLMYGSLPSFHAIMGPLQALLT
DHLADCSHPQELQELCQSTLTEMESQKQLCRPLTCEKSKPVPLKLFTPRLVKVLEFGRKQ
GSSKEEQERKRLIHKHKREFKGAVREIRKDNQFLARMQLSEIMERDAERKRKVKQLFNSL
ATQEGEWKALKRKKFKK
Function Involved in nucleolar processing of pre-18S ribosomal RNA. Has a role in the nuclear export of 40S pre-ribosomal subunit to the cytoplasm.
Reactome Pathway
Major pathway of rRNA processing in the nucleolus and cytosol (R-HSA-6791226 )
rRNA modification in the nucleus and cytosol (R-HSA-6790901 )

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Definitive Biomarker [1]
Matthew-Wood syndrome DISA7HR7 Strong Biomarker [2]
Pancreatic cancer DISJC981 Strong Biomarker [3]
Breast cancer DIS7DPX1 Disputed Biomarker [4]
Breast carcinoma DIS2UE88 Disputed Biomarker [4]
Invasive breast carcinoma DISANYTW Disputed Altered Expression [4]
Melanocytic nevus DISYS32D Disputed Altered Expression [1]
Melanoma DIS1RRCY Disputed Biomarker [1]
Neoplasm DISZKGEW Limited Altered Expression [1]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Nucleolar protein 14 (NOP14). [5]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Nucleolar protein 14 (NOP14). [6]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Nucleolar protein 14 (NOP14). [7]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Nucleolar protein 14 (NOP14). [8]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Nucleolar protein 14 (NOP14). [9]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the mutagenesis of Nucleolar protein 14 (NOP14). [10]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Nucleolar protein 14 (NOP14). [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 NOP14 inhibits melanoma proliferation and metastasis by regulating Wnt/-catenin signaling pathway.Braz J Med Biol Res. 2018 Nov 23;52(1):e7952. doi: 10.1590/1414-431X20187952.
2 Pancreatic Cancer Progression Relies upon Mutant p53-Induced Oncogenic Signaling Mediated by NOP14.Cancer Res. 2017 May 15;77(10):2661-2673. doi: 10.1158/0008-5472.CAN-16-2339. Epub 2017 Mar 9.
3 NOP14 promotes proliferation and metastasis of pancreatic cancer cells.Cancer Lett. 2012 Sep 28;322(2):195-203. doi: 10.1016/j.canlet.2012.03.010. Epub 2012 Mar 14.
4 NOP14 suppresses breast cancer progression by inhibiting NRIP1/Wnt/-catenin pathway.Oncotarget. 2015 Sep 22;6(28):25701-14. doi: 10.18632/oncotarget.4573.
5 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
6 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
7 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
8 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
9 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
10 Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.
11 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.