Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTL98XZO)

• DOT Name: MORN repeat-containing protein 2 (MORN2)
• Synonyms: MORN motif protein in testis
• Gene Name: MORN2
• Related Disease:
  Bacterial infection
  Tuberculosis
• UniProt ID: MORN2_HUMAN
• Pfam ID: PF02493
• Sequence:
  MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLE
  WSGNFHFTAAPDLKLKLHM
• Function: Might have a role in spermatogenesis.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bacterial infection	DIS5QJ9S	Definitive	Biomarker	[1]
Tuberculosis	DIS2YIMD	Definitive	Biomarker	[1]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of MORN repeat-containing protein 2 (MORN2).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of MORN repeat-containing protein 2 (MORN2).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of MORN repeat-containing protein 2 (MORN2).	[4]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of MORN repeat-containing protein 2 (MORN2).	[5]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of MORN repeat-containing protein 2 (MORN2).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of MORN repeat-containing protein 2 (MORN2).	[7]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of MORN repeat-containing protein 2 (MORN2).	[8]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of MORN repeat-containing protein 2 (MORN2).	[9]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of MORN repeat-containing protein 2 (MORN2).	[10]

References

• [1] Screening in planarians identifies MORN2 as a key component in LC3-associated phagocytosis and resistance to bacterial infection.Cell Host Microbe. 2014 Sep 10;16(3):338-50. doi: 10.1016/j.chom.2014.08.002.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [4] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [5] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [6] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [7] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [8] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [9] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [10] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.