Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLUBG86)

• DOT Name: B-cell receptor-associated protein 29 (BCAP29)
• Synonyms: BCR-associated protein 29; Bap29
• Gene Name: BCAP29
• Related Disease:
  Osteoarthritis
  Coronary heart disease
• UniProt ID: BAP29_HUMAN
• PDB ID: 4W7Y; 4W7Z; 4W80
• Pfam ID: PF05529 ; PF18035
• Sequence:
  MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLI
  VLFLDAVREVRKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRL
  VTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKL
  VEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKR
  L
• Function: May play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. May be involved in CASP8-mediated apoptosis.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Osteoarthritis	DIS05URM	Strong	Genetic Variation	[1]
Coronary heart disease	DIS5OIP1	moderate	Genetic Variation	[2]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of B-cell receptor-associated protein 29 (BCAP29).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of B-cell receptor-associated protein 29 (BCAP29).	[12]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of B-cell receptor-associated protein 29 (BCAP29).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of B-cell receptor-associated protein 29 (BCAP29).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of B-cell receptor-associated protein 29 (BCAP29).	[6]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of B-cell receptor-associated protein 29 (BCAP29).	[7]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of B-cell receptor-associated protein 29 (BCAP29).	[8]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of B-cell receptor-associated protein 29 (BCAP29).	[8]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of B-cell receptor-associated protein 29 (BCAP29).	[9]
Sulindac	DM2QHZU	Approved	Sulindac increases the expression of B-cell receptor-associated protein 29 (BCAP29).	[10]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of B-cell receptor-associated protein 29 (BCAP29).	[11]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of B-cell receptor-associated protein 29 (BCAP29).	[13]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde increases the expression of B-cell receptor-associated protein 29 (BCAP29).	[14]

References

• [1] Gene expression analysis reveals HBP1 as a key target for the osteoarthritis susceptibility locus that maps to chromosome 7q22.Ann Rheum Dis. 2012 Dec;71(12):2020-7. doi: 10.1136/annrheumdis-2012-201304. Epub 2012 May 14.
• [2] Identification of 64 Novel Genetic Loci Provides an Expanded View on the Genetic Architecture of Coronary Artery Disease.Circ Res. 2018 Feb 2;122(3):433-443. doi: 10.1161/CIRCRESAHA.117.312086. Epub 2017 Dec 6.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [8] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [9] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [10] Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
• [11] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [12] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [13] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [14] Comparative DNA microarray analysis of human monocyte derived dendritic cells and MUTZ-3 cells exposed to the moderate skin sensitizer cinnamaldehyde. Toxicol Appl Pharmacol. 2009 Sep 15;239(3):273-83.