| DOT Name |
Zinc finger protein 385A
|
| Synonyms |
Hematopoietic zinc finger protein; Retinal zinc finger protein |
| Gene Name |
ZNF385A
|
| Related Disease |
- Tourette syndrome ( )
|
| UniProt ID |
|
| 3D Structure |
|
| Pfam ID |
|
| Sequence |
MILGSLSRAGPLPLLRQPPIMQPPLDLKQILPFPLEPAPTLGLFSNYSTMDPVQKAVLSH
TFGGPLLKTKRPVISCNICQIRFNSQSQAEAHYKGNRHARRVKGIEAAKTRGREPGVREP
GDPAPPGSTPTNGDGVAPRPVSMENGLGPAPGSPEKQPGSPSPPSIPETGQGVTKGEGGT
PAPASLPGGSKEEEEKAKRLLYCALCKVAVNSLSQLEAHNKGTKHKTILEARSGLGPIKA
YPRLGPPTPGEPEAPAQDRTFHCEICNVKVNSEVQLKQHISSRRHRDGVAGKPNPLLSRH
KKSRGAGELAGTLTFSKELPKSLAGGLLPSPLAVAAVMAAAAGSPLSLRPAPAAPLLQGP
PITHPLLHPAPGPIRTAHGPILFSPY
|
| Function |
RNA-binding protein that affects the localization and the translation of a subset of mRNA. May play a role in adipogenesis through binding to the 3'-UTR of CEBPA mRNA and regulation of its translation. Targets ITPR1 mRNA to dendrites in Purkinje cells, and may regulate its activity-dependent translation. With ELAVL1, binds the 3'-UTR of p53/TP53 mRNAs to control their nuclear export induced by CDKN2A. Hence, may regulate p53/TP53 expression and mediate in part the CDKN2A anti-proliferative activity. May also bind CCNB1 mRNA. Alternatively, may also regulate p53/TP53 activity through direct protein-protein interaction. Interacts with p53/TP53 and promotes cell-cycle arrest over apoptosis enhancing preferentially the DNA binding and transactivation of p53/TP53 on cell-cycle arrest target genes over proapoptotic target genes. May also regulate the ubiquitination and stability of CDKN1A promoting DNA damage-induced cell cycle arrest. Also plays a role in megakaryocytes differentiation.
|
| Tissue Specificity |
Expressed predominantly in the retina. |
| KEGG Pathway |
- p53 sig.ling pathway (hsa04115 )
|
| Reactome Pathway |
- TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest (R-HSA-6804116 )
- Regulation of TP53 Activity through Association with Co-factors (R-HSA-6804759 )
- Transcriptional activation of cell cycle inhibitor p21 (R-HSA-69895 )
- TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest (R-HSA-6804114 )
|
|
|
|
|
|
|
