Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMG63Z6)

DOT Name Sorting nexin-8 (SNX8)
Gene Name SNX8
Related Disease
Alzheimer disease ( )
Amyloidosis ( )
Head and neck cancer ( )
Head and neck carcinoma ( )
Neuralgia ( )
UniProt ID
SNX8_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00787 ; PF19566
Sequence
MTGRAMDPLPAAAVGAAAEAEADEEADPPASDLPTPQAIEPQAIVQQVPAPSRMQMPQGN
PLLLSHTLQELLARDTVQVELIPEKKGLFLKHVEYEVSSQRFKSSVYRRYNDFVVFQEML
LHKFPYRMVPALPPKRMLGADREFIEARRRALKRFVNLVARHPLFSEDVVLKLFLSFSGS
DVQNKLKESAQCVGDEFLNCKLATRAKDFLPADIQAQFAISRELIRNIYNSFHKLRDRAE
RIASRAIDNAADLLIFGKELSAIGSDTTPLPSWAALNSSTWGSLKQALKGLSVEFALLAD
KAAQQGKQEENDVVEKLNLFLDLLQSYKDLCERHEKGVLHKHQRALHKYSLMKRQMMSAT
AQNREPESVEQLESRIVEQENAIQTMELRNYFSLYCLHQETQLIHVYLPLTSHILRAFVN
SQIQGHKEMSKVWNDLRPKLSCLFAGPHSTLTPPCSPPEDGLCPH
Function May be involved in several stages of intracellular trafficking. May play a role in intracellular protein transport from early endosomes to the trans-Golgi network.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Alzheimer disease DISF8S70 Strong Biomarker [1]
Amyloidosis DISHTAI2 Strong Biomarker [1]
Head and neck cancer DISBPSQZ Strong Genetic Variation [2]
Head and neck carcinoma DISOU1DS Strong Genetic Variation [2]
Neuralgia DISWO58J Strong Genetic Variation [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Sorting nexin-8 (SNX8). [3]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Sorting nexin-8 (SNX8). [7]
Fulvestrant DM0YZC6 Approved Fulvestrant increases the methylation of Sorting nexin-8 (SNX8). [9]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Sorting nexin-8 (SNX8). [10]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Sorting nexin-8 (SNX8). [9]
------------------------------------------------------------------------------------
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Sorting nexin-8 (SNX8). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Sorting nexin-8 (SNX8). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Sorting nexin-8 (SNX8). [6]
Quercetin DM3NC4M Approved Quercetin increases the expression of Sorting nexin-8 (SNX8). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Sorting nexin-8 (SNX8). [4]
------------------------------------------------------------------------------------

References

1 SNX8 Enhances Non-amyloidogenic APP Trafficking and Attenuates A Accumulation and Memory Deficits in an AD Mouse.Front Cell Neurosci. 2019 Sep 6;13:410. doi: 10.3389/fncel.2019.00410. eCollection 2019.
2 Genome-wide association study identifies genes associated with neuropathy in patients with head and neck cancer.Sci Rep. 2018 Jun 8;8(1):8789. doi: 10.1038/s41598-018-27070-4.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
8 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
9 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
10 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.