Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMG6NG0)

DOT Name	Vesicle-trafficking protein SEC22c (SEC22C)
Synonyms	SEC22 vesicle-trafficking protein homolog C; SEC22 vesicle-trafficking protein-like 3
Gene Name	SEC22C
UniProt ID	SC22C_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF13774
Sequence	MSVIFFACVVRVRDGLPLSASTDFYHTQDFLEWRRRLKSLALRLAQYPGRGSAEGCDFSI HFSSFGDVACMAICSCQCPAAMAFCFLETLWWEFTASYDTTCIGLASRPYAFLEFDSIIQ KVKWHFNYVSSSQMECSLEKIQEELKLQPPAVLTLEDTDVANGVMNGHTPMHLEPAPNFR MEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNILAFLVPFVACIFQCYL YLFYSPARTMKVVLMLLFICLGNMYLHGLRNLWQILFHIGVAFLSSYQILTRQLQEKQSD CGV
Function	May be involved in vesicle transport between the ER and the Golgi complex.
Tissue Specificity	Ubiquitously expressed.
Reactome Pathway	COPII-mediated vesicle transport (R-HSA-204005 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Vesicle-trafficking protein SEC22c (SEC22C).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Vesicle-trafficking protein SEC22c (SEC22C).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Vesicle-trafficking protein SEC22c (SEC22C).	[3]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Vesicle-trafficking protein SEC22c (SEC22C).	[4]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Vesicle-trafficking protein SEC22c (SEC22C).	[5]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Vesicle-trafficking protein SEC22c (SEC22C).	[6]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Vesicle-trafficking protein SEC22c (SEC22C).	[7]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Vesicle-trafficking protein SEC22c (SEC22C).	[8]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Drug(s)

References

1	Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
3	Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
4	Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
5	Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
6	CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
7	Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
8	Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.