Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMT25MN)

• DOT Name: SLAIN motif-containing protein 1 (SLAIN1)
• Gene Name: SLAIN1
• Related Disease: Hepatocellular carcinoma
• UniProt ID: SLAI1_HUMAN
• Pfam ID: PF15301
• Sequence:
  MMAEQVKCASAGVSSGAGSGPVVNAELEVKKLQELVRKLEKQNEQLRSRAASAAAAPHLL
  LLPPPPPAAPPPAGLQPLGPRSPPAATATAAASGGLGPAFPGTFCLPSPAPSLLCSLAQP
  PEAPFVYFKPAAGFFGAGGGGPEPGGAGTPPGAAAAPPSPPPTLLDEVELLDLESVAAWR
  DEDDYTWLYIGSSKTFTSSEKSLTPLQWCRHVLDNPTPEMEAARRSLCFRLEQGYTSRGS
  PLSPQSSIDSELSTSELEDDSISMGYKLQDLTDVQIMARLQEESLRQDYASTSASVSRHS
  SSVSLSSGKKGTCSDQEYDQYSLEDEEEFDHLPPPQPRLPRCSPFQRGIPHSQTFSSIRE
  CRRSPSSQYFPSNNYQQQQYYSPQAQTPDQQPNRTNGDKLRRSMPNLARMPSTTAISSNI
  SSPVTVRNSQSFDSSLHGAGNGISRIQSCIPSPGQLQHRVHSVGHFPVSIRQPLKATAYV
  SPTVQGSSNMPLSNGLQLYSNTGIPTPNKAAASGIMGRSALPRPSLAINGSNLPRSKIAQ
  PVRSFLQPPKPLSSLSTLRDGNWRDGCY
• Function: Microtubule plus-end tracking protein that might be involved in the regulation of cytoplasmic microtubule dynamics, microtubule organization and microtubule elongation.
• Tissue Specificity: Expressed in embryonic stem cells . Expressed in brain .

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[1]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of SLAIN motif-containing protein 1 (SLAIN1).	[2]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of SLAIN motif-containing protein 1 (SLAIN1).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of SLAIN motif-containing protein 1 (SLAIN1).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of SLAIN motif-containing protein 1 (SLAIN1).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of SLAIN motif-containing protein 1 (SLAIN1).	[6]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of SLAIN motif-containing protein 1 (SLAIN1).	[7]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of SLAIN motif-containing protein 1 (SLAIN1).	[8]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of SLAIN motif-containing protein 1 (SLAIN1).	[9]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of SLAIN motif-containing protein 1 (SLAIN1).	[10]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of SLAIN motif-containing protein 1 (SLAIN1).	[11]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of SLAIN motif-containing protein 1 (SLAIN1).	[12]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of SLAIN motif-containing protein 1 (SLAIN1).	[13]
GALLICACID	DM6Y3A0	Investigative	GALLICACID increases the expression of SLAIN motif-containing protein 1 (SLAIN1).	[14]

References

• [1] Hsa_circ_101280 promotes hepatocellular carcinoma by regulating miR-375/JAK2.Immunol Cell Biol. 2019 Feb;97(2):218-228. doi: 10.1111/imcb.12213. Epub 2018 Nov 26.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [5] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [7] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [8] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [9] Endometrial receptivity is affected in women with high circulating progesterone levels at the end of the follicular phase: a functional genomics analysis. Hum Reprod. 2011 Jul;26(7):1813-25.
• [10] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [11] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [12] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [13] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [14] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.