Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTN4HBAA)

DOT Name Serine/threonine-protein kinase 32C (STK32C)
Synonyms EC 2.7.11.1; PKE; Yet another novel kinase 3
Gene Name STK32C
Related Disease
Depression ( )
Neoplasm ( )
Acute myelogenous leukaemia ( )
Bladder cancer ( )
Pneumococcal meningitis ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
UniProt ID
ST32C_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
2.7.11.1
Pfam ID
PF00069
Sequence
MRSGAERRGSSAAASPGSPPPGRARPAGSDAPSALPPPAAGQPRARDSGDVRSQPRPLFQ
WSKWKKRMGSSMSAATARRPVFDDKEDVNFDHFQILRAIGKGSFGKVCIVQKRDTEKMYA
MKYMNKQQCIERDEVRNVFRELEILQEIEHVFLVNLWYSFQDEEDMFMVVDLLLGGDLRY
HLQQNVQFSEDTVRLYICEMALALDYLRGQHIIHRDVKPDNILLDERGHAHLTDFNIATI
IKDGERATALAGTKPYMAPEIFHSFVNGGTGYSFEVDWWSVGVMAYELLRGWRPYDIHSS
NAVESLVQLFSTVSVQYVPTWSKEMVALLRKLLTVNPEHRLSSLQDVQAAPALAGVLWDH
LSEKRVEPGFVPNKGRLHCDPTFELEEMILESRPLHKKKKRLAKNKSRDNSRDSSQSEND
YLQDCLDAIQQDFVIFNREKLKRSQDLPREPLPAPESRDAAEPVEDEAERSALPMCGPIC
PSAGSG

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Depression DIS3XJ69 Strong Biomarker [1]
Neoplasm DISZKGEW Strong Biomarker [2]
Acute myelogenous leukaemia DISCSPTN moderate Genetic Variation [3]
Bladder cancer DISUHNM0 Limited Biomarker [2]
Pneumococcal meningitis DISM5U0L Limited Genetic Variation [4]
Urinary bladder cancer DISDV4T7 Limited Biomarker [2]
Urinary bladder neoplasm DIS7HACE Limited Biomarker [2]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Serine/threonine-protein kinase 32C (STK32C). [5]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Serine/threonine-protein kinase 32C (STK32C). [8]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Serine/threonine-protein kinase 32C (STK32C). [9]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Serine/threonine-protein kinase 32C (STK32C). [10]
------------------------------------------------------------------------------------
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Estradiol DMUNTE3 Approved Estradiol increases the expression of Serine/threonine-protein kinase 32C (STK32C). [6]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Serine/threonine-protein kinase 32C (STK32C). [7]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of Serine/threonine-protein kinase 32C (STK32C). [11]
------------------------------------------------------------------------------------

References

1 Genome-wide methylomic analysis of monozygotic twins discordant for adolescent depression.Biol Psychiatry. 2014 Dec 15;76(12):977-83. doi: 10.1016/j.biopsych.2014.04.013. Epub 2014 May 6.
2 Serine/threonine kinase 32C is overexpressed in bladder cancer and contributes to tumor progression.Cancer Biol Ther. 2019;20(3):307-320. doi: 10.1080/15384047.2018.1529098. Epub 2018 Oct 25.
3 Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
4 Joint sequencing of human and pathogen genomes reveals the genetics of pneumococcal meningitis.Nat Commun. 2019 May 15;10(1):2176. doi: 10.1038/s41467-019-09976-3.
5 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
6 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
7 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
8 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
9 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
10 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
11 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.