Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNTQULB)

• DOT Name: Galectin-12 (LGALS12)
• Synonyms: Gal-12; Galectin-related inhibitor of proliferation
• Gene Name: LGALS12
• Related Disease:
  Colorectal carcinoma
  Obesity
  Promyelocytic leukaemia
  Acute myelogenous leukaemia
• UniProt ID: LEG12_HUMAN
• Pfam ID: PF00337
• Sequence:
  MSQPSGGRAPGTRIYSWSCPTVMSPGEKLDPIPDSFILQPPVFHPVVPYVTTIFGGLHAG
  KMVMLQGVVPLDAHRFQVDFQCGCSLCPRPDIAFHFNPRFHTTKPHVICNTLHGGRWQRE
  ARWPHLALRRGSSFLILFLFGNEEVKVSVNGQHFLHFRYRLPLSHVDTLGIFGDILVEAV
  GFLNINPFVEGSREYPAGHPFLLMSPRLEVPCSHALPQGLSPGQVIIVRGLVLQEPKHFT
  VSLRDQAAHAPVTLRASFADRTLAWISRWGQKKLISAPFLFYPQRFFEVLLLFQEGGLKL
  ALNGQGLGATSMNQQALEQLRELRISGSVQLYCVHS
• Function: Binds lactose. May participate in the apoptosis of adipocytes.
• Tissue Specificity: Not widely expressed. Predominantly expressed in adipose tissue.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[1]
Obesity	DIS47Y1K	Strong	Altered Expression	[2]
Promyelocytic leukaemia	DISYGG13	Strong	Biomarker	[3]
Acute myelogenous leukaemia	DISCSPTN	Disputed	Altered Expression	[3]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Galectin-12 (LGALS12).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Galectin-12 (LGALS12).	[5]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Galectin-12 (LGALS12).	[6]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Galectin-12 (LGALS12).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Galectin-12 (LGALS12).	[9]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Galectin-12 (LGALS12).	[10]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Galectin-12 (LGALS12).	[7]

References

• [1] Analyzing epigenetic control of galectin expression indicates silencing of galectin-12 by promoter methylation in colorectal cancer.IUBMB Life. 2017 Dec;69(12):962-970. doi: 10.1002/iub.1690. Epub 2017 Nov 3.
• [2] Allyl Isothiocyanate Ameliorates Obesity by Inhibiting Galectin-12.Mol Nutr Food Res. 2018 Mar;62(6):e1700616. doi: 10.1002/mnfr.201700616. Epub 2018 Mar 12.
• [3] Galectin-12 inhibits granulocytic differentiation of human NB4 promyelocytic leukemia cells while promoting lipogenesis.J Leukoc Biol. 2016 Oct;100(4):657-664. doi: 10.1189/jlb.1HI0316-134R. Epub 2016 Jun 2.
• [4] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [5] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [6] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Highly active combination of BRD4 antagonist and histone deacetylase inhibitor against human acute myelogenous leukemia cells. Mol Cancer Ther. 2014 May;13(5):1142-54.
• [9] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [10] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.