Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTP1GZYF)

• DOT Name: dCTP pyrophosphatase 1 (DCTPP1)
• Synonyms: EC 3.6.1.12; Deoxycytidine-triphosphatase 1; dCTPase 1; RS21C6; XTP3-transactivated gene A protein
• Gene Name: DCTPP1
• UniProt ID: DCTP1_HUMAN
• PDB ID: 7MU5
• EC Number: 3.6.1.12
• Pfam ID: PF12643
• Sequence:
  MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLAL
  VGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLS
  KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST
• Function: Hydrolyzes deoxynucleoside triphosphates (dNTPs) to the corresponding nucleoside monophosphates. Has a strong preference for dCTP and its analogs including 5-iodo-dCTP and 5-methyl-dCTP for which it may even have a higher efficiency. May protect DNA or RNA against the incorporation of these genotoxic nucleotide analogs through their catabolism.
• KEGG Pathway:
  Pyrimidine metabolism (hsa00240)
  Metabolic pathways (hsa01100)
  Nucleotide metabolism (hsa01232)
• Reactome Pathway: Interconversion of nucleotide di- and triphosphates (R-HSA-499943)

Molecular Interaction Atlas (MIA) of This DOT

20 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of dCTP pyrophosphatase 1 (DCTPP1).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of dCTP pyrophosphatase 1 (DCTPP1).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of dCTP pyrophosphatase 1 (DCTPP1).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of dCTP pyrophosphatase 1 (DCTPP1).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of dCTP pyrophosphatase 1 (DCTPP1).	[5]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of dCTP pyrophosphatase 1 (DCTPP1).	[6]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of dCTP pyrophosphatase 1 (DCTPP1).	[7]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of dCTP pyrophosphatase 1 (DCTPP1).	[8]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of dCTP pyrophosphatase 1 (DCTPP1).	[9]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of dCTP pyrophosphatase 1 (DCTPP1).	[10]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of dCTP pyrophosphatase 1 (DCTPP1).	[11]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of dCTP pyrophosphatase 1 (DCTPP1).	[11]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of dCTP pyrophosphatase 1 (DCTPP1).	[12]
DNCB	DMDTVYC	Phase 2	DNCB decreases the expression of dCTP pyrophosphatase 1 (DCTPP1).	[13]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of dCTP pyrophosphatase 1 (DCTPP1).	[15]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of dCTP pyrophosphatase 1 (DCTPP1).	[16]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of dCTP pyrophosphatase 1 (DCTPP1).	[18]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of dCTP pyrophosphatase 1 (DCTPP1).	[19]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of dCTP pyrophosphatase 1 (DCTPP1).	[20]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of dCTP pyrophosphatase 1 (DCTPP1).	[21]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of dCTP pyrophosphatase 1 (DCTPP1).	[14]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of dCTP pyrophosphatase 1 (DCTPP1).	[17]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
• [7] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [8] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [9] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [10] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [11] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [12] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [13] Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
• [14] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [15] BET bromodomain inhibition as a therapeutic strategy to target c-Myc. Cell. 2011 Sep 16;146(6):904-17.
• [16] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [17] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [18] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [19] Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
• [20] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [21] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.