Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPJ3RQ4)

• DOT Name: Short coiled-coil protein (SCOC)
• Gene Name: SCOC
• Related Disease: Thyroid gland papillary carcinoma
• UniProt ID: SCOC_HUMAN
• PDB ID: 4BWD; 7AA7
• Pfam ID: PF10224
• Sequence:
  MRRRVFSSQDWRASGWDGMGFFSRRTFCGRSGRSCRGQLVQVSRPEVSAGSLLLPAPQAE
  DHSSRILYPRPKSLLPKMMNADMDAVDAENQVELEEKTRLINQVLELQHTLEDLSARVDA
  VKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSKRK
• Function: Positive regulator of amino acid starvation-induced autophagy.
• Tissue Specificity: Widely expressed with highest levels in brain, heart and skeletal muscle.
• Reactome Pathway: Retrograde transport at the Trans-Golgi-Network (R-HSA-6811440)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Thyroid gland papillary carcinoma	DIS48YMM	Definitive	Biomarker	[1]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Short coiled-coil protein (SCOC).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Short coiled-coil protein (SCOC).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Short coiled-coil protein (SCOC).	[4]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Short coiled-coil protein (SCOC).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Short coiled-coil protein (SCOC).	[6]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Short coiled-coil protein (SCOC).	[7]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Short coiled-coil protein (SCOC).	[8]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Short coiled-coil protein (SCOC).	[9]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Short coiled-coil protein (SCOC).	[10]
APR-246	DMNFADH	Phase 2	APR-246 affects the expression of Short coiled-coil protein (SCOC).	[11]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Short coiled-coil protein (SCOC).	[14]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Short coiled-coil protein (SCOC).	[12]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Short coiled-coil protein (SCOC).	[13]

References

• [1] Identification of differentiated functional modules in papillary thyroid carcinoma by analyzing differential networks.J Cancer Res Ther. 2018 Dec;14(Supplement):S969-S974. doi: 10.4103/jcrt.JCRT_730_16.
• [2] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [3] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [6] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [7] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [8] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [9] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [10] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [11] Mutant p53 reactivation by PRIMA-1MET induces multiple signaling pathways converging on apoptosis. Oncogene. 2010 Mar 4;29(9):1329-38. doi: 10.1038/onc.2009.425. Epub 2009 Nov 30.
• [12] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [13] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [14] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.