Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPOV391)

DOT Name Coiled-coil domain-containing protein 136 (CCDC136)
Synonyms Nasopharyngeal carcinoma-associated gene 6 protein
Gene Name CCDC136
Related Disease
Carcinoma ( )
Gastric cancer ( )
Neoplasm ( )
Specific language impairment ( )
Stomach cancer ( )
UniProt ID
CC136_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MQAMEGEVLLPALYEEEEEEEEEEEEVEEEEEQVQKGGSVGSLSVNKHRGLSLTETELEE
LRAQVLQLVAELEETRELAGQHEDDSLELQGLLEDERLASAQQAEVFTKQIQQLQGELRS
LREEISLLEHEKESELKEIEQELHLAQAEIQSLRQAAEDSATEHESDIASLQEDLCRMQN
ELEDMERIRGDYEMEIASLRAEMEMKSSEPSGSLGLSDYSGLQEELQELRERYHFLNEEY
RALQESNSSLTGQLADLESERTQRATERWLQSQTLSMTSAESQTSEMDFLEPDPEMQLLR
QQLRDAEEQMHGMKNKCQELCCELEELQHHRQVSEEEQRRLQRELKCAQNEVLRFQTSHS
VTQNEELKSRLCTLQKKYDTSQDEQNELLKMQLQLQTELRQLKVMKSTLVENQSEKELLC
RLQKLHLQHQNVTCEKEKLLERQQQLQEELQCHEAELQHLRDTVASFKESNEKDTETHAQ
LQEMKQLYQASKDELERQKHMYDQLEQDLLLCQLELKELKASHPIPEDKGKCANKCDTLL
SRLTELQEKYKASQKEMGQLQMEQCELLEDQRRMQEEQGQLQEELHRLTLPLPKSGLLLK
SQELLTKLEDLCELQLLYQGMQEEQKKLIQNQDCVLKEQLEIHEELRRFKESHFQEVLEN
PDDSKLAKSSKCNRNKQSKLLMEQMQALQVMYDAGQAKQELLQQEQGRLLEERKRLQADL
QLCLEEMQLLQVQSPSIKMSLESYGKSYGSMVPSNENCRKTYDTTVDDNESYYKSYTSTQ
TSSKSFLKSYDSSTSASEAYGKSYCTTSNSSITYKKSYGSTSSSDTCQKSFVSSCTDEEP
AEPEDMERFEEMVVKVLIKLQAVQAMYQISQEEHSQLQEQMEKLLAKQKDLKEELDACER
EFKECMECLEKPMAPQNDKNEIKELQTKLRELQLQYQASMDEQGRLLVVQEQLEGQLQCC
QEELRQLREKRPSVVKEARGKNANKNMNKNANGVKMKKVTKPCSDTSESDLETRKSLEVV
LYYKASQRKLDGLAKEEEKKEEMEEEKKQVKEEAKEQCGDELVAEPADPEEAKSTEDQEE
NEEDKEEEEKEEDSEEEEDDADSSLESPEENNPLRLSESKKSSPTPNPPIFSLPLVGLVV
ISALLWCWWAETSS
Function May play a role in acrosome formation in spermatogenesis and in fertilization.
Tissue Specificity Expressed in gastric tissues. Down-regulated in gastric cancer.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Carcinoma DISH9F1N Strong Biomarker [1]
Gastric cancer DISXGOUK Strong Biomarker [1]
Neoplasm DISZKGEW Strong Biomarker [1]
Specific language impairment DISEKRML Strong Genetic Variation [2]
Stomach cancer DISKIJSX Strong Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Coiled-coil domain-containing protein 136 (CCDC136). [3]
------------------------------------------------------------------------------------
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Coiled-coil domain-containing protein 136 (CCDC136). [4]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Coiled-coil domain-containing protein 136 (CCDC136). [5]
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of Coiled-coil domain-containing protein 136 (CCDC136). [6]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Coiled-coil domain-containing protein 136 (CCDC136). [7]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Coiled-coil domain-containing protein 136 (CCDC136). [6]
Panobinostat DM58WKG Approved Panobinostat decreases the expression of Coiled-coil domain-containing protein 136 (CCDC136). [8]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Coiled-coil domain-containing protein 136 (CCDC136). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Coiled-coil domain-containing protein 136 (CCDC136). [9]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Coiled-coil domain-containing protein 136 (CCDC136). [10]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Coiled-coil domain-containing protein 136 (CCDC136). [11]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Coiled-coil domain-containing protein 136 (CCDC136). [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)

References

1 Expression of tumor related gene NAG6 in gastric cancer and restriction fragment length polymorphism analysis.World J Gastroenterol. 2004 May 1;10(9):1361-4. doi: 10.3748/wjg.v10.i9.1361.
2 Genome-wide screening for DNA variants associated with reading and language traits.Genes Brain Behav. 2014 Sep;13(7):686-701. doi: 10.1111/gbb.12158. Epub 2014 Aug 29.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
5 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
6 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
7 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
8 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
9 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
10 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
11 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
12 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.